BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0532.Seq (570 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 28 0.25 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 1.3 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 1.7 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 25 1.7 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 25 2.3 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 4.0 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 24 4.0 AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-tran... 24 4.0 AY994090-1|AAX86003.1| 85|Anopheles gambiae hyp6.2 precursor p... 23 5.3 X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal p... 23 9.3 AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding pr... 23 9.3 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 9.3 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 27.9 bits (59), Expect = 0.25 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = +2 Query: 245 VFHSVL-RWCAS-SLWRTVTVFLHRLVAVRLPQ 337 +FHS+ + C + S+W TVT+ + R +AV PQ Sbjct: 132 MFHSIFAQICHTISIWLTVTLAIWRYIAVAYPQ 164 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 25.4 bits (53), Expect = 1.3 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +1 Query: 385 PPGPRASRGVRGP 423 PPGP+ + G+RGP Sbjct: 105 PPGPKGNPGLRGP 117 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 1.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 383 DHLDPVPRVECVVLHEPPSPTLDVIFVHGLYGSLSNT 493 DHL P P +C +L P+ T+ + + +S+T Sbjct: 223 DHLLPSPAEQCRILASKPAETIKIDTSGRAFDRMSST 259 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.0 bits (52), Expect = 1.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 383 DHLDPVPRVECVVLHEPPSPTLDVIFVHGLYGSLSNT 493 DHL P P +C +L P+ T+ + + +S+T Sbjct: 224 DHLLPSPAEQCRILASKPAETIKIDTSGRAFDRMSST 260 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 325 QTAANQSETSQNEAQGAGDRPPGPRASR 408 + AA ++ T Q +A+ PP PR R Sbjct: 1062 RNAARRAATQQRQAERLPPPPPSPRTER 1089 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.8 bits (49), Expect = 4.0 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +1 Query: 313 ISRRQTAANQSETSQNEAQGAGDRPPGPRASRGVRGPARAAFSYPRRH 456 ++RRQ +E+S +E G+G G + G G A S P H Sbjct: 1490 LNRRQRKKQHTESSDDENGGSGG---GSGSGAGGAGSAGPNHSSPSNH 1534 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.8 bits (49), Expect = 4.0 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +1 Query: 364 AQGAGD-RP--PGPRASRGVRGP 423 A G G+ RP PGP+ RG GP Sbjct: 402 APGGGEGRPGAPGPKGPRGYEGP 424 >AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-transferase u3 protein. Length = 218 Score = 23.8 bits (49), Expect = 4.0 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +1 Query: 466 WAIRILKQHLASRRWKP---TYKSEPELKTLINH 558 W + + +LA + +KP Y SEP+ + LINH Sbjct: 66 WESKAIVTYLAEQ-YKPGCTLYPSEPKKRGLINH 98 >AY994090-1|AAX86003.1| 85|Anopheles gambiae hyp6.2 precursor protein. Length = 85 Score = 23.4 bits (48), Expect = 5.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 232 SDCTRISFGATVVCFELMEDGHRFPASISRR 324 +D R++ GAT + + G RF +SRR Sbjct: 46 ADIGRLATGATKLFGQFWNTGTRFGTELSRR 76 >X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal protein homologue protein. Length = 269 Score = 22.6 bits (46), Expect = 9.3 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 58 DQTNIELDNVFRLYQQGQTIVNVISG 135 D +++ N+F+ Q G+T+VN G Sbjct: 29 DWYDVKAPNMFKNRQSGKTLVNRTQG 54 >AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding protein AgamOBP11 protein. Length = 192 Score = 22.6 bits (46), Expect = 9.3 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -3 Query: 232 TLPCPPFCGSISRDAAILFKPSVGYLD 152 +LPCP C + + +P YLD Sbjct: 142 SLPCPDRCTAAYKQELCFQEPIAKYLD 168 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 22.6 bits (46), Expect = 9.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 176 KQDGGVT*NTSTKWRTR 226 +Q+G T + T+WRTR Sbjct: 223 RQEGPSTRESGTRWRTR 239 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 595,342 Number of Sequences: 2352 Number of extensions: 12235 Number of successful extensions: 26 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -