BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0526.Seq (670 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.86 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.86 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 2.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.0 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.86 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = -1 Query: 463 VDHESIYKLH*FGTLTTQLARYNNFTTTGTRFHDETENTIASTTYSETSD 314 VD + K T+ T L +Y N+T F + + TY +T + Sbjct: 1162 VDEMEVRKTSALTTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYCQTEE 1211 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.86 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = -1 Query: 463 VDHESIYKLH*FGTLTTQLARYNNFTTTGTRFHDETENTIASTTYSETSD 314 VD + K T+ T L +Y N+T F + + TY +T + Sbjct: 1158 VDEMEVRKTSALTTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYCQTEE 1207 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 131 DLRADGSDPHFH 96 ++ DGS PHFH Sbjct: 621 EISQDGSSPHFH 632 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 146 QDTECARRERTQ 181 QD +C R+ERTQ Sbjct: 1646 QDHDCIRQERTQ 1657 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 459 STLETLAMITSTLLPDIASQARSTRNQGQNH 551 ST+++L + S D+A +ARS + +H Sbjct: 738 STIQSLMKLKSPEWKDLAKKARSVNHLLTHH 768 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 119 PLGDHYYGHQDTECARRERT 178 PL +H Y D++ + ERT Sbjct: 1329 PLSEHIYSSIDSDYSTLERT 1348 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,281 Number of Sequences: 438 Number of extensions: 4096 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -