BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0521.Seq (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 25 0.77 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 9.4 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 9.4 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 9.4 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 9.4 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 9.4 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 9.4 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 25.0 bits (52), Expect = 0.77 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -2 Query: 137 RIATLEVKFLDLRKTNFSESICQRCFHQSRT 45 +I+TL+ LD+ + E++ Q CF Q++T Sbjct: 180 KISTLDA-ILDIIRNMVPENLVQACFQQAQT 209 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 9.4 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 145 PVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSSIFSPFEHS 267 P +N KT I R++ ++ YS+S F+P +S Sbjct: 287 PFFCVNIVTSYCKTC-ISGRAFQVLTWLGYSNSAFNPIIYS 326 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 422 SAAHKCNYELFNRNNFSIRYWSWNY 496 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 422 SAAHKCNYELFNRNNFSIRYWSWNY 496 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 422 SAAHKCNYELFNRNNFSIRYWSWNY 496 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 422 SAAHKCNYELFNRNNFSIRYWSWNY 496 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 422 SAAHKCNYELFNRNNFSIRYWSWNY 496 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,765 Number of Sequences: 438 Number of extensions: 4738 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -