BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0516.Seq (533 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 23 1.3 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 9.0 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 9.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 9.0 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 9.0 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 23.4 bits (48), Expect = 1.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 432 GATTFTVIPRDATSRAS 482 G TFT + DAT RA+ Sbjct: 105 GTATFTAVAADATKRAT 121 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 20.6 bits (41), Expect = 9.0 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 318 LHSWHPTKQLTSR 280 LHSW T LTSR Sbjct: 107 LHSWLGTGLLTSR 119 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 20.6 bits (41), Expect = 9.0 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 124 GKTCRDLVANFS 89 G TC DLV +FS Sbjct: 234 GGTCHDLVNSFS 245 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.6 bits (41), Expect = 9.0 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 345 PRRPAGTCARIPARWSALSA 404 PR+PA T A P R SA A Sbjct: 919 PRQPAETHAGSPCRNSASPA 938 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 20.6 bits (41), Expect = 9.0 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = -2 Query: 487 KSLAREVASRGITVNVVAPGFIETDMTRALSADQRAGILAQVPAGR 350 +S A ++S G+T AP T S A +PA R Sbjct: 16 QSAATPISSSGMTSPAAAPPPATTSSGSPASVASNASAPLHIPAKR 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,234 Number of Sequences: 336 Number of extensions: 2782 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -