BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0508.Seq (560 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 25 0.59 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 23 2.4 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 22 4.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 5.5 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 9.6 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 24.6 bits (51), Expect = 0.59 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 401 AFIPVWTPTVLFVV 360 AF +WTP V+FVV Sbjct: 115 AFFLLWTPAVIFVV 128 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 22.6 bits (46), Expect = 2.4 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 181 GWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELCCQLNRVGKHLPQPISLR 29 GWS+D + D+ NV K E L + C L + G+ P + L+ Sbjct: 17 GWSEDTTHKYTTKYDNIDLENVVKNERLLKSYVDCLLEK-GRCSPDGLELK 66 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 145 GEFTRDMGNVEKIELLPYHE 86 G+FT +MG + EL +H+ Sbjct: 282 GDFTENMGTLGYNELCEFHK 301 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 5.5 Identities = 10/28 (35%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 439 LSLQDCFTAGCGNAAAGSVHKV-AKVTT 519 +S C +AGC A HK +TT Sbjct: 345 ISFMACSSAGCSQKVAEERHKTDINITT 372 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 328 YFQQFINHRIVTT 366 Y Q INHR+V T Sbjct: 324 YSLQLINHRVVFT 336 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,188 Number of Sequences: 336 Number of extensions: 2804 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -