BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0508.Seq (560 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 1.6 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 3.7 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 22 4.9 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 6.4 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 6.4 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.5 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 410 LQARNQSRTNSACRIASPPDAVTPPPEAFIKW 505 + R Q+ T++ PPD+ PPP+ W Sbjct: 643 IMPRVQNATDTTNFDEYPPDSDPPPPDDISGW 674 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 3.7 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 Query: 377 LVSRQV*MPSFLQARNQSRTNSACRIASPPDAVTPPPE 490 L SR P L+A N SACRI P PP+ Sbjct: 422 LDSRDELHPRELEAVN---LGSACRIHGSPATTAAPPQ 456 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 96 GRSSIFSTLPISRVNSPRRCAESSSSDQ 179 G S+ S+ + + R+C ESS DQ Sbjct: 235 GVSNFLSSTRTAETGTIRKCDESSPHDQ 262 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 6.4 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 454 CFTAGCGNAAAGSVHKVAKVTTSFIKSSTVTSLP 555 CFT G + + K+ + SST T+ P Sbjct: 299 CFTGGPRKSHESQCPMLQKLEKPVLSSSTTTTSP 332 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 6.4 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 402 GIHTCLDTNGFVRR 361 G+H+C GF RR Sbjct: 80 GVHSCEGCKGFFRR 93 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.0 bits (42), Expect = 8.5 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +1 Query: 262 NSNQILVDLVVHLLEIEHYQVGYFQQFINHRIVTTNKT 375 N+ ILV + VH++ + Y + F F ++ T+ T Sbjct: 566 NTLWILVMVSVHVVALVLYLLDRFSPFGRFKLANTDGT 603 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,217 Number of Sequences: 438 Number of extensions: 3414 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -