BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0503X.Seq (514 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118863-1|AAM50723.1| 77|Drosophila melanogaster GM24338p pro... 28 8.5 AE014296-692|AAN11570.1| 77|Drosophila melanogaster CG32266-PA... 28 8.5 >AY118863-1|AAM50723.1| 77|Drosophila melanogaster GM24338p protein. Length = 77 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = -1 Query: 370 ITSCSTTAPISASRPWSRRLGVKAPSGAKAYTGTVISS 257 +T+ S +P+ A+ P++ G+ AP+ + AYT V ++ Sbjct: 23 LTAYSAASPVVAATPYAYSGGLYAPTYSAAYTSGVYAA 60 >AE014296-692|AAN11570.1| 77|Drosophila melanogaster CG32266-PA protein. Length = 77 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = -1 Query: 370 ITSCSTTAPISASRPWSRRLGVKAPSGAKAYTGTVISS 257 +T+ S +P+ A+ P++ G+ AP+ + AYT V ++ Sbjct: 23 LTAYSAASPVVAATPYAYSGGLYAPTYSAAYTSGVYAA 60 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,003,793 Number of Sequences: 53049 Number of extensions: 266641 Number of successful extensions: 581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1867000320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -