BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0503X.Seq (514 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g22920.1 68417.m03310 expressed protein 28 3.2 At2g34010.1 68415.m04164 expressed protein 27 9.8 >At4g22920.1 68417.m03310 expressed protein Length = 268 Score = 28.3 bits (60), Expect = 3.2 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = -1 Query: 427 ESIRPEANRVETVGVTVIMITSCSTTAPISASRPWSRRLGVKAPSGAKAYTGT 269 E++ P+ ++ ET+ CS P +S PWS L + G Y+GT Sbjct: 207 EAVSPDGHKTETLP-EARCADECSCCFPTVSSIPWSHSL---SNEGVNGYSGT 255 >At2g34010.1 68415.m04164 expressed protein Length = 211 Score = 26.6 bits (56), Expect = 9.8 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 Query: 421 IRPEANRVETVGVTVIMITSCSTTAPISASRPWS 320 I P+A + ++G+T + T +T+ PI+ P S Sbjct: 105 ISPDATQNRSMGITPVQETGTTTSNPIAIDSPTS 138 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,823,532 Number of Sequences: 28952 Number of extensions: 126966 Number of successful extensions: 257 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 257 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -