BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0497.Seq (595 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11040.1 68414.m01265 DNAJ chaperone C-terminal domain-contai... 27 7.1 >At1g11040.1 68414.m01265 DNAJ chaperone C-terminal domain-containing protein contains Pfam profile PF01556: DnaJ C terminal region Length = 438 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +2 Query: 308 TEEHRDRILILNRRFLERRLT--DDMLRKRVSITADACTDSAAHKCNYELFNRNN 466 +E H D ++RR+LE + DD++ R + + DS+ K L + ++ Sbjct: 38 SESHSDADSAIHRRYLEEKFAEEDDLIAARRGLRLQSMDDSSVFKRRSSLLSNSS 92 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,398,457 Number of Sequences: 28952 Number of extensions: 208492 Number of successful extensions: 446 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1180950720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -