BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0496.Seq (751 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O96078 Cluster: EFPDE4; n=1; Ephydatia fluviatilis|Rep:... 34 4.3 UniRef50_Q64WD5 Cluster: Putative capsular polysaccharide polyme... 33 5.7 >UniRef50_O96078 Cluster: EFPDE4; n=1; Ephydatia fluviatilis|Rep: EFPDE4 - Ephydatia fluviatilis Length = 698 Score = 33.9 bits (74), Expect = 4.3 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 100 FHQIKKRSLFAALSIIYIVFLNRVSTISSK 189 +H K R LF+ + I+ VFLN +STI SK Sbjct: 379 YHVFKARDLFSEMKIVPSVFLNFISTIESK 408 >UniRef50_Q64WD5 Cluster: Putative capsular polysaccharide polymerase; n=1; Bacteroides fragilis|Rep: Putative capsular polysaccharide polymerase - Bacteroides fragilis Length = 345 Score = 33.5 bits (73), Expect = 5.7 Identities = 13/30 (43%), Positives = 23/30 (76%) Frame = +1 Query: 124 LFAALSIIYIVFLNRVSTISSKLIL*NAKL 213 +FA +SI++I+F N++++ SKLI+ N L Sbjct: 228 IFAGISILFIIFWNKLNSFKSKLIMENMNL 257 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 669,028,916 Number of Sequences: 1657284 Number of extensions: 12738366 Number of successful extensions: 24356 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24352 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61734884250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -