BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0494.Seq (759 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 2.5 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 5.9 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 5.9 AY724802-1|AAW50311.1| 134|Anopheles gambiae G protein alpha su... 23 7.7 AY724801-1|AAW50310.1| 134|Anopheles gambiae G protein alpha su... 23 7.7 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.0 bits (52), Expect = 2.5 Identities = 12/50 (24%), Positives = 25/50 (50%) Frame = -2 Query: 557 DACPFKRFTAFRYKECQSFSSIPSCFCSNTSYLSVHSAINILLIDKSDSF 408 D F T+ R + C+ C CS+ + +H+ + +++ID+ +F Sbjct: 817 DESQFCNETSVRDRNCRQ----EFCECSHVLQIPLHATVEMVMIDEGFTF 862 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.8 bits (49), Expect = 5.9 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -2 Query: 116 ILLTFATTTCWTPRYIFV 63 +++ A CWTP YI + Sbjct: 419 VVIVVAFVVCWTPYYIMM 436 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.8 bits (49), Expect = 5.9 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -2 Query: 116 ILLTFATTTCWTPRYIFV 63 +++ A CWTP YI + Sbjct: 420 VVIVVAFVVCWTPYYIMM 437 >AY724802-1|AAW50311.1| 134|Anopheles gambiae G protein alpha subunit AgOn protein. Length = 134 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/32 (31%), Positives = 12/32 (37%) Frame = -2 Query: 557 DACPFKRFTAFRYKECQSFSSIPSCFCSNTSY 462 D PF K S S + CFC + Y Sbjct: 103 DTEPFSEDLLLAMKRLWSDSGVQECFCRSNEY 134 >AY724801-1|AAW50310.1| 134|Anopheles gambiae G protein alpha subunit AgOa protein. Length = 134 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/32 (31%), Positives = 12/32 (37%) Frame = -2 Query: 557 DACPFKRFTAFRYKECQSFSSIPSCFCSNTSY 462 D PF K S S + CFC + Y Sbjct: 103 DTEPFSEDLLLAMKRLWSDSGVQECFCRSNEY 134 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,532 Number of Sequences: 2352 Number of extensions: 12356 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -