BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0493.Seq (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45790| Best HMM Match : SERTA (HMM E-Value=2.8e-07) 31 0.75 SB_38746| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) 31 0.99 SB_36051| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_37048| Best HMM Match : Phage_tube (HMM E-Value=7.3) 30 1.3 SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) 30 1.3 SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) 30 1.3 SB_4516| Best HMM Match : rve (HMM E-Value=6.5) 30 1.3 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 30 1.7 SB_51968| Best HMM Match : PT (HMM E-Value=0.54) 30 1.7 SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_37120| Best HMM Match : EB (HMM E-Value=4.2) 30 1.7 SB_50931| Best HMM Match : Extensin_2 (HMM E-Value=0.14) 29 2.3 SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) 29 2.3 SB_29642| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_27280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_53641| Best HMM Match : rve (HMM E-Value=7.9e-14) 29 3.0 SB_31102| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_25791| Best HMM Match : GASA (HMM E-Value=9.9) 29 3.0 SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_18792| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_4506| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_59489| Best HMM Match : RnaseH (HMM E-Value=0.0047) 29 3.0 SB_58621| Best HMM Match : RVT_1 (HMM E-Value=1.5e-25) 29 3.0 SB_54350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_51440| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_16804| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26) 29 3.0 SB_4690| Best HMM Match : rve (HMM E-Value=1.5) 29 3.0 SB_4584| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_47661| Best HMM Match : zf-CCHC (HMM E-Value=0.015) 28 5.3 SB_18896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_11755| Best HMM Match : GST_C (HMM E-Value=2.7e-05) 28 5.3 SB_11561| Best HMM Match : HAT (HMM E-Value=1.1) 28 5.3 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 28 5.3 SB_38092| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 28 5.3 SB_21496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_42700| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_19120| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) 28 7.0 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 28 7.0 SB_38362| Best HMM Match : BRCT (HMM E-Value=0) 28 7.0 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_16617| Best HMM Match : Vicilin_N (HMM E-Value=5.5) 28 7.0 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_44929| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_19775| Best HMM Match : Arm (HMM E-Value=0.27) 27 9.2 SB_2776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_45306| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) 27 9.2 SB_35722| Best HMM Match : CutA1 (HMM E-Value=8.3) 27 9.2 SB_12542| Best HMM Match : Collagen (HMM E-Value=1.3) 27 9.2 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_45790| Best HMM Match : SERTA (HMM E-Value=2.8e-07) Length = 1213 Score = 31.1 bits (67), Expect = 0.75 Identities = 22/84 (26%), Positives = 36/84 (42%), Gaps = 4/84 (4%) Frame = +1 Query: 250 ENKSKPLPPELIAINTPNAQGRKAIQNVIH-NIQQLVKGVSASDPTEVASAPLPAKFEPP 426 E+ + P + A N G + + ++ ++ V + T + P K EP Sbjct: 525 ESPALHTPENVGASERANTSGSEVLSKLLSGSVTSCVSSTPSGPSTFILYIPSFRKIEPK 584 Query: 427 IE---KKDTPKMETPKKPGPASKP 489 E K +TP+ ETP+K AS P Sbjct: 585 PELEVKDETPEKETPEKDLKASSP 608 >SB_38746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 30.7 bits (66), Expect = 0.99 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 5/84 (5%) Frame = +1 Query: 274 PELIAINTPNAQGRKAIQNVIHNIQQL-VKGVSASDPTEVASAPLPAKFEPPIEKK---- 438 P + + P A+ Q++ ++L + SA+D E + P P +PP E + Sbjct: 276 PAQVPKDDPEAKAALLRQHIRPTGEKLSLNNTSATDDYEPVAEPAPNGNQPPTEPRTSTP 335 Query: 439 DTPKMETPKKPGPASKPWRPTLMP 510 TP TP + GP + T+ P Sbjct: 336 GTPAKSTPTQSGPPLRRSTRTVKP 359 >SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) Length = 1199 Score = 30.7 bits (66), Expect = 0.99 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 2/83 (2%) Frame = +1 Query: 220 DATQTEKL*RENKSKPLPPELIAINTPNAQGRKAIQNVIHNIQQLVKGVSASDPTEVASA 399 +AT T+KL ++ ++ + PE+ A+N + N + + + VKG+S S +A Sbjct: 176 EATSTDKL-KQKSAEVIRPEIPAVNQEELAAANKVFNSLFSGSRGVKGIS-STVQIIADM 233 Query: 400 PLPAKFEPPIEKKDTP--KMETP 462 P P + + + P K+E P Sbjct: 234 PAPWPTVSHVLQAEEPSWKLEEP 256 >SB_36051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.7 bits (66), Expect = 0.99 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = +1 Query: 340 NIQQLVKGVSASDPTEVASAPLPAKFEPPIEKKDTPKMETPKKPGP 477 N QQ K SAS EVA P PAK P ++D+P +P+ P Sbjct: 58 NAQQ--KRKSASPKQEVARTPSPAKASP---RRDSPVQASPRNASP 98 >SB_37048| Best HMM Match : Phage_tube (HMM E-Value=7.3) Length = 270 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/56 (32%), Positives = 23/56 (41%) Frame = +3 Query: 426 YREKRHSKDGDT*ETRASQQTVETHTHAITPENLARIAREPTASGGRWAPGVQHRA 593 YR + S G T RA + HTH + P+ L +R GRW Q A Sbjct: 194 YRRYKASCKGYT--ARARSEDCGHHTHGVDPDTLLHCSRSEVFLFGRWLRDKQEAA 247 >SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) Length = 172 Score = 30.3 bits (65), Expect = 1.3 Identities = 21/82 (25%), Positives = 35/82 (42%) Frame = +1 Query: 277 ELIAINTPNAQGRKAIQNVIHNIQQLVKGVSASDPTEVASAPLPAKFEPPIEKKDTPKME 456 +L+ + AQ R+ + + H+ ++ ++ V D T S P P PP++ D Sbjct: 94 DLMEESEEEAQRREEMLKMYHSTKEALQIVGDID-THTISIPTP----PPVDNSDFDPRR 148 Query: 457 TPKKPGPASKPWRPTLMPLLRR 522 P P P P P P+ R Sbjct: 149 PPAPPKPGGAPPIPGRPPIPSR 170 >SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) Length = 325 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 361 GVSASDPTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRPT 501 G +DPT A P P + +TP ++ GPA KP RP+ Sbjct: 10 GSKKNDPTSPAKKPPPRRRSRETPP-ETPPVQLKHLAGPAEKPHRPS 55 >SB_4516| Best HMM Match : rve (HMM E-Value=6.5) Length = 262 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E S P P +PP E + TP TP + GP + T+ P Sbjct: 201 LNNTSATDDYEPVSEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 256 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 29.9 bits (64), Expect = 1.7 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 3/89 (3%) Frame = +1 Query: 232 TEKL*RENKSKPLPPELIAINTPNAQGRKAIQNVIHNIQQLVKGVSASD--PTEVASAPL 405 TE+ + + KPL E + ++ A K ++ I ++ V+ V PTE + PL Sbjct: 6173 TEREAKPLEEKPLIEEELRVSAEKAVEEKPLEKPIARKEKKVEEVKPKKEKPTEREAKPL 6232 Query: 406 PAKFEPPIEKKD-TPKMETPKKPGPASKP 489 K P +E+K+ T +E + P KP Sbjct: 6233 KEK--PLVEEKELTVSVEKAVEEKPLEKP 6259 >SB_51968| Best HMM Match : PT (HMM E-Value=0.54) Length = 514 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 379 PTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRPTLMPLLRRT 525 PT+ + PL + EP E+K TP+ P K P + RPT P + T Sbjct: 222 PTKKPTKPLLPEVEPEEEEKATPR---PTKAKPTTIKRRPTERPTKKPT 267 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +1 Query: 379 PTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRPTLMPLLRRT 525 PT+ + PL + EP E++ TP+ P K P + RPT P + T Sbjct: 182 PTKKPTKPLLPEVEPEEEERATPR---PTKAKPTTMKRRPTERPTKKPT 227 Score = 28.7 bits (61), Expect = 4.0 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +1 Query: 379 PTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRPTLMPLLRRT 525 PT+ + PL + EP E++ TP+ P K P + RPT P + T Sbjct: 345 PTKKPTKPLLPEVEPEEEERATPR---PTKAKPTTIKRRPTERPTKKPT 390 >SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 29.9 bits (64), Expect = 1.7 Identities = 28/109 (25%), Positives = 45/109 (41%) Frame = +1 Query: 199 KNNHASPDATQTEKL*RENKSKPLPPELIAINTPNAQGRKAIQNVIHNIQQLVKGVSASD 378 +N+ A Q+ K + N PLP + A P+ + ++ + + + V S+ Sbjct: 302 QNDEMRKLAAQSPK--KLNAPAPLPQGVFA-TLPSPKSASPPRHTLPRPEPIGGPVRGSE 358 Query: 379 PTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRPTLMPLLRRT 525 P VA A P P TP+ E P G + + R +P RRT Sbjct: 359 PKGVARADAPPV---PARTDQTPRPERPVPAGASPQSRRRRPVPTPRRT 404 >SB_37120| Best HMM Match : EB (HMM E-Value=4.2) Length = 376 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 406 PAKFEPPIEKKDTPKMETPKKPGPASKP 489 P K P +KK PK KKP A KP Sbjct: 298 PTKKPTPAKKKPAPKKPAAKKPAKAKKP 325 >SB_50931| Best HMM Match : Extensin_2 (HMM E-Value=0.14) Length = 348 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 59 PSGLRPRGQRPTCAQSPPVSLLEYRKIPSLKGKS 160 PS +PRG++P ++PPV+ K P L+G + Sbjct: 98 PSNAKPRGKKPASVKTPPVA---NEKGPDLQGNA 128 >SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) Length = 534 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/63 (23%), Positives = 26/63 (41%) Frame = +3 Query: 186 QRVIQK*PCLPRCNPNRKALKRKQKQTFASGADSDKHSQRSREEGHTECDT*HSAAGEGC 365 + +Q C+ P + + K + +GA D+ + RE T CD ++ C Sbjct: 430 KETVQSSLCVSTLGPEKFKITSKMVHVYQTGAGYDEICTQRREISKTRCDLFQTSDKSLC 489 Query: 366 QCV 374 CV Sbjct: 490 CCV 492 >SB_29642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 215 LNNTSATDDYEPVAEPAPNDNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 270 >SB_27280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 980 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 919 LNNTSATDDYEPVAEPAPNDNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 974 >SB_53641| Best HMM Match : rve (HMM E-Value=7.9e-14) Length = 691 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 630 LNNTSATDDYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 685 >SB_31102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 29.1 bits (62), Expect = 3.0 Identities = 24/81 (29%), Positives = 31/81 (38%) Frame = +1 Query: 253 NKSKPLPPELIAINTPNAQGRKAIQNVIHNIQQLVKGVSASDPTEVASAPLPAKFEPPIE 432 NK+ PL ++ NT Q IQ + + K A T + S P + P Sbjct: 50 NKTLPLEVKVRLYNTALTQWLDWIQEAKESGKGRSKETDAQLRTPLPSPPSESP-STPFG 108 Query: 433 KKDTPKMETPKKPGPASKPWR 495 TP TPK P PWR Sbjct: 109 ILPTPPTNTPKSRIPRPFPWR 129 >SB_25791| Best HMM Match : GASA (HMM E-Value=9.9) Length = 234 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -3 Query: 382 WGPTH*HPSPAAE-CYVSHSVWPSSLERWECL 290 WG T P P C +S W SSL+ W L Sbjct: 141 WGNTMRMPPPLGRLCIISTFTWTSSLQNWSTL 172 >SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1995 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +1 Query: 367 SASDPTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRPTLMPLLRR 522 SA + A+AP K P+ ++ P + KKP A RP P L+R Sbjct: 1419 SAKNRPSTAAAPEEPK---PVARQRGPTADNDKKPAKAQPVARPATAPALKR 1467 >SB_18792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 793 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 732 LNNTSATDDYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 787 >SB_4506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 23 LNNTSATDDYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 78 >SB_59489| Best HMM Match : RnaseH (HMM E-Value=0.0047) Length = 567 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 506 LNNTSATDDYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 561 >SB_58621| Best HMM Match : RVT_1 (HMM E-Value=1.5e-25) Length = 1238 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 1177 LNNTSATDDYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 1232 >SB_54350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 863 LNNTSATDDYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 918 >SB_51440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 38 LNNTSATDDYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 93 >SB_16804| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26) Length = 921 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 860 LNNTSATDDYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 915 >SB_4690| Best HMM Match : rve (HMM E-Value=1.5) Length = 282 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 221 LNNTSATDDYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 276 >SB_4584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGPASKPWRPTLMP 510 + SA+D E + P P +PP E + TP TP + GP + T+ P Sbjct: 54 LNNTSATDDYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGPPLRRSTRTVKP 109 >SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2749 Score = 28.7 bits (61), Expect = 4.0 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 5/47 (10%) Frame = +1 Query: 394 SAPLPAKFEP--PIEKKDTPKMETPKKPGPASKPWR---PTLMPLLR 519 S+P P+K P + K D PK + P+KP P KP R TL L+R Sbjct: 1427 SSPPPSKNGPLNSVRKVDDPKDDLPRKP-PPPKPRRSFTATLEDLMR 1472 >SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +1 Query: 376 DPTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRPTLMPLLRRT 525 D TEV + P ++ P+ E P P P S+ T + L+ R+ Sbjct: 232 DKTEVKGRTISVALSNPPTRRGPPRQEHPPPPPPGSRGRAKTQLQLIPRS 281 >SB_47661| Best HMM Match : zf-CCHC (HMM E-Value=0.015) Length = 830 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 482 ANRGDPHSCHYSGELGADSPRTDGKWRSMGARC 580 A + D H C Y GE GA P D ++ G +C Sbjct: 251 ARKKDRHKCDYCGETGAHKPGKD--CQAYGKQC 281 >SB_18896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 379 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 468 TRASQQTVETHTHAITPENLARIAREPTAS 557 T A+ QT + T A TP+N ++R P AS Sbjct: 267 TAATLQTTQATTPATTPDNRQYLSRSPDAS 296 >SB_11755| Best HMM Match : GST_C (HMM E-Value=2.7e-05) Length = 142 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 207 PCLPRCNPNRKALKRKQKQTFASG 278 P LPR +P+++AL R+ T ASG Sbjct: 12 PLLPRGDPHKRALVRQISMTIASG 35 >SB_11561| Best HMM Match : HAT (HMM E-Value=1.1) Length = 409 Score = 28.3 bits (60), Expect = 5.3 Identities = 20/74 (27%), Positives = 36/74 (48%) Frame = +1 Query: 289 INTPNAQGRKAIQNVIHNIQQLVKGVSASDPTEVASAPLPAKFEPPIEKKDTPKMETPKK 468 I + N QG + + V + ++ V ++S+ + + P P+K P + K TPK+ TPK Sbjct: 5 IYSNNNQGDRK-KGVSKDKEKQVANRNSSETRDQSVGPEPSKVTPKVTPKVTPKV-TPKV 62 Query: 469 PGPASKPWRPTLMP 510 + P + P Sbjct: 63 TPKVTPKVTPKVTP 76 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 28.3 bits (60), Expect = 5.3 Identities = 17/79 (21%), Positives = 33/79 (41%), Gaps = 2/79 (2%) Frame = +1 Query: 256 KSKPLPPELIAINTPNAQGRKAIQNVIHNIQQLVKGVSASDPTEVASAPLPAKFEP--PI 429 +S+ L +A N G+K + H Q+ + + A P+P P P+ Sbjct: 667 RSEVLRERALAAKRRNTMGQKIVIEAPHTPPQIPTRTGSVNKPSRAPPPVPNHPSPAVPL 726 Query: 430 EKKDTPKMETPKKPGPASK 486 ++ K P++P P ++ Sbjct: 727 RREGDTKSFAPQRPPPPTR 745 >SB_38092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 439 DTPKMETPKKPGPASKPW 492 D ETPK PGP SK W Sbjct: 35 DHEHKETPKSPGPLSKRW 52 >SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 1042 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +1 Query: 358 KGVSASDPTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRP 498 KG P + LP F D+P+ P P P PW P Sbjct: 984 KGTVVEVPLDAVLNRLPRHFPRAARPPDSPRDPPPITPPPPPVPWFP 1030 >SB_21496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1787 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 482 ANRGDPHSCHYSGELGADSPRTDGKWRSMGARC 580 A + D H C Y GE GA P D ++ G +C Sbjct: 74 ARKKDRHKCDYCGETGAHKPGKD--CQAYGKQC 104 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 27.9 bits (59), Expect = 7.0 Identities = 21/67 (31%), Positives = 27/67 (40%) Frame = +1 Query: 289 INTPNAQGRKAIQNVIHNIQQLVKGVSASDPTEVASAPLPAKFEPPIEKKDTPKMETPKK 468 I +P AQ + A ++Q V G+S P P K P KK +PK PK Sbjct: 4551 ITSPRAQNQPA-----EKLEQKVLGLSLDSSPPTKRPPPPVK--PKSIKKTSPKEVAPKP 4603 Query: 469 PGPASKP 489 G P Sbjct: 4604 GGSPHAP 4610 >SB_42700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +1 Query: 379 PTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRP 498 P E + P AK EK D E+P +P PWRP Sbjct: 26 PNERKARPFSAKARISTEKVDIQTAESPSRP-----PWRP 60 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +1 Query: 367 SASDPTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKP 489 S + PT+ P P K TP T KP PA+ P Sbjct: 60 SPTAPTQTTPTPATPTPTTPTPKTPTPTTSTLTKPTPATTP 100 >SB_19120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 423 SYREKRHSKDGDT*ETRASQQTVETHTHAITPEN 524 SYR K +T ET+++ +T ET + TPEN Sbjct: 796 SYRLKFTQSTTETPETQSTTETPETQSTTETPEN 829 >SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) Length = 679 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +1 Query: 355 VKGVSASDPTEVASAPLPAKFEPPIEKK----DTPKMETPKKPGP 477 + SA+D E + P P +PP E + TP TP + GP Sbjct: 273 LNNTSATDDYEPVAEPAPNGNQPPTEPRTSTPGTPAKSTPTQSGP 317 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 27.9 bits (59), Expect = 7.0 Identities = 20/81 (24%), Positives = 32/81 (39%), Gaps = 2/81 (2%) Frame = +1 Query: 274 PELIAINTPNAQGRKAIQNVIHNIQQLVKGVSASDPTEVASAP--LPAKFEPPIEKKDTP 447 P +A+ P+ + + N + G S + + +S P PA PP + T Sbjct: 281 PATMALPLPDYGDAQTTNEIAANGE--TSGPSEPESSNKSSEPDSTPATNAPPSDSPSTT 338 Query: 448 KMETPKKPGPASKPWRPTLMP 510 TP+ P P + P L P Sbjct: 339 TPTTPQPPTPTTPKTHPQLGP 359 >SB_38362| Best HMM Match : BRCT (HMM E-Value=0) Length = 1572 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 373 SDPTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRP 498 S PT PLP F+P KK P+ + ++P RP Sbjct: 1283 SSPTTQTPLPLPVAFQPKEVKKPEPQNLLEEHSDSPTEPPRP 1324 >SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2492 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +3 Query: 198 QK*PCLPRCNPNRKALKRKQKQTFASGADSDKHSQRSR 311 QK LPRC PNR+ KQ S + + + R R Sbjct: 1412 QKAQTLPRCKPNRRRHTTKQPSESDSSDEDPRLTTRDR 1449 >SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1417 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 379 PTEVASAPL-PAKFEPPIEKKDTPKMETPKKPGPASKPWRPT 501 P+ ++ P+ P+ PI+ + TP KP P++ P +P+ Sbjct: 1268 PSTTSTTPIKPSPSTNPIKPSPSTTSTTPIKPSPSTTPIKPS 1309 >SB_16617| Best HMM Match : Vicilin_N (HMM E-Value=5.5) Length = 547 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 376 DPTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRP 498 DP + A+ PA+ P +K T K +T K G + RP Sbjct: 484 DPDQQAARKRPARTRPASGQKKTSKAKTSKPQGQDKQAARP 524 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/66 (22%), Positives = 26/66 (39%) Frame = +1 Query: 292 NTPNAQGRKAIQNVIHNIQQLVKGVSASDPTEVASAPLPAKFEPPIEKKDTPKMETPKKP 471 N+ Q A++ ++ ++ + + A+ P+ A P P P P P P Sbjct: 329 NSVAIQKISALEEELNRLRLQIASLVANPPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Query: 472 GPASKP 489 P S P Sbjct: 389 APGSTP 394 >SB_44929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 67 PTTTWPATHLRAESSGQSARV 129 P TWPAT L +S+G+S ++ Sbjct: 11 PNLTWPATDLDWQSAGRSRKI 31 >SB_19775| Best HMM Match : Arm (HMM E-Value=0.27) Length = 607 Score = 27.5 bits (58), Expect = 9.2 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +2 Query: 449 RWRHLRNQG-QPANRGDPHSCHYSGELGA--DSPRTDGKWRSMGARCAASCKS 598 R R L NQ QP +R S + +L D P+ DG RS + SC S Sbjct: 312 RGRDLGNQSSQPGSRASQLSHQLNRDLAEQRDQPKPDGFRRSQKSEATGSCAS 364 >SB_2776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1792 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 52 KAAFGPTTTW-PATHLRAESSGQSARVPEN 138 + FGPTTT P L+ + S ARVPE+ Sbjct: 1090 EVTFGPTTTTQPQDPLKNQESDVKARVPED 1119 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 480 QQTVETHTHAITPENLARIAR 542 Q T ET TH + PE L+RI + Sbjct: 653 QSTNETSTHVVLPEKLSRIKK 673 >SB_45306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1576 Score = 27.5 bits (58), Expect = 9.2 Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 3/92 (3%) Frame = +1 Query: 250 ENKSKPLPPELIAI--NTPNAQGRKAIQNVIHNIQQLVKGVSAS-DPTEVASAPLPAKFE 420 ++ + P+PP ++ TP A Q + + Q + ++A D T +AS +P Sbjct: 818 KSSTPPVPPASLSTISTTPQPITTSAPQPITTSAAQPITTLAAGPDVTGMASPAVPG--- 874 Query: 421 PPIEKKDTPKMETPKKPGPASKPWRPTLMPLL 516 P D P + P PG P PLL Sbjct: 875 PQAGLPDLPGLGEPHGPGNGQPPLEAFGQPLL 906 >SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) Length = 1211 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -3 Query: 370 H*HPSPAAECYVSHSVWPSSLERWECLSLSAPEAKVCFCFL 248 H HPSP+ VSH + L + P K CF FL Sbjct: 464 HSHPSPSQPSPVSHPPAQALLHTSHPSPATHPSPKPCFTFL 504 >SB_35722| Best HMM Match : CutA1 (HMM E-Value=8.3) Length = 171 Score = 27.5 bits (58), Expect = 9.2 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 1/92 (1%) Frame = +1 Query: 250 ENKSKPLPPELIAINTPNAQGRKAIQNVIHNI-QQLVKGVSASDPTEVASAPLPAKFEPP 426 +N S PL ++ N Q K +Q V + + ++++PT + P P P Sbjct: 49 KNTSLPLDAKIRQYNRVLNQYLKWLQQVKDDGGTNRTRSSASAEPT--LNLPSPPSKTPS 106 Query: 427 IEKKDTPKMETPKKPGPASKPWRPTLMPLLRR 522 +TP P P + RP+ +P L+R Sbjct: 107 SASSQAKVDKTPLLPSPPTNTPRPSRIPRLKR 138 >SB_12542| Best HMM Match : Collagen (HMM E-Value=1.3) Length = 532 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 455 RHLRNQGQPANRGDPHSC-HYSGELGADSPRTDGKWRSMG 571 RH+ G P C H G GAD PR+ G WR G Sbjct: 365 RHVILTAAARTVGIPGGCGHPVG--GADGPRSSGVWREFG 402 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 379 PTEVASAPLPAKFEPPIEKKDTPKMETPKKPGPASKPWRP 498 P+EV + PA PP+ K TPK P + P P P Sbjct: 740 PSEVTTKSPPA---PPLPPKVTPKPPAPPQFAPVPPPCAP 776 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,425,428 Number of Sequences: 59808 Number of extensions: 503326 Number of successful extensions: 1801 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 1532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1778 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -