BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0489.Seq (771 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 25 0.51 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 25 0.51 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 25 0.51 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 25 0.88 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 22 4.7 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 22 6.2 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 25.4 bits (53), Expect = 0.51 Identities = 18/64 (28%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +1 Query: 532 DITMLGGHSSHSYQNGTNMY-FVYDY-NVVDCKPEEEIDKYHNPLNKIICEETIRLGGSM 705 D+ M G HS H N Y + D N P Y +P EET + Sbjct: 4 DVGMYGHHSQHGTYPSDNYYNYTSDIPNAQQMPPHYSNYHYEDPYGYTGSEETPPSPQEV 63 Query: 706 VHHH 717 +HH Sbjct: 64 YYHH 67 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 25.4 bits (53), Expect = 0.51 Identities = 18/64 (28%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +1 Query: 532 DITMLGGHSSHSYQNGTNMY-FVYDY-NVVDCKPEEEIDKYHNPLNKIICEETIRLGGSM 705 D+ M G HS H N Y + D N P Y +P EET + Sbjct: 4 DVGMYGHHSQHGTYPSDNYYNYTSDIPNAQQMPPHYSNYHYEDPYGYTGSEETPPSPQEV 63 Query: 706 VHHH 717 +HH Sbjct: 64 YYHH 67 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 25.4 bits (53), Expect = 0.51 Identities = 18/64 (28%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +1 Query: 532 DITMLGGHSSHSYQNGTNMY-FVYDY-NVVDCKPEEEIDKYHNPLNKIICEETIRLGGSM 705 D+ M G HS H N Y + D N P Y +P EET + Sbjct: 4 DVGMYGHHSQHGTYPSDNYYNYTSDIPNAQQMPPHYSNYHYEDPYGYTGSEETPPSPQEV 63 Query: 706 VHHH 717 +HH Sbjct: 64 YYHH 67 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 24.6 bits (51), Expect = 0.88 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 640 DKYHNPLNKIICEETIRLGGSMVHHHGIGKHRVHWSKLE 756 D H +K C ET + G + H I R W++LE Sbjct: 69 DALHTECSK--CSETQKNGSKKIMRHLIDHKRDWWNELE 105 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 22.2 bits (45), Expect = 4.7 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 640 DKYHNPLNKIICEETIRLGGSMVHHHGIGKHRVHWSKLE 756 D H+ +K C E + G + H+ I R W++LE Sbjct: 69 DALHSGCSK--CTEKQKEGSRKIIHYLIDNKRDWWNELE 105 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +3 Query: 354 SKPGLTT*TGDRIKWLPNVCRSSKPATW 437 S P ++ G KWLP + S P+ W Sbjct: 200 SLPSISPSGGFLPKWLPPLQGFSDPSAW 227 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,974 Number of Sequences: 336 Number of extensions: 4543 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -