BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0488.Seq (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 25 3.3 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 24 4.4 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 4.4 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 23 7.7 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -1 Query: 584 CRYPVPSRRVRNARDLPWRRRRCT 513 CR P RR R+ R W R R T Sbjct: 271 CRSPPARRRSRSTRPTSWPRSRPT 294 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 24.2 bits (50), Expect = 4.4 Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 3/72 (4%) Frame = +2 Query: 236 ISHNLCYSKDDT--KDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEE-ENTEKRSQNLDE 406 I H + + T K+ + + + KK+Q + E YK + + EE E E+ D+ Sbjct: 436 IRHMAMHDPESTVSKEMEALREGRQKKVQITFEEEIYKGEEDYEGEEDEEDEEDEYEGDD 495 Query: 407 AKKILLQEDPSL 442 ++ ED L Sbjct: 496 TEEDEEDEDDEL 507 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 24.2 bits (50), Expect = 4.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 487 WSEDMHQRWVHRL 525 W E +H RW +RL Sbjct: 858 WDESVHGRWTYRL 870 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 23.4 bits (48), Expect = 7.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 755 PGGASPINSQ*SAVSS*PPGAFFPSGTASN 666 PG A P + +A + PP A P T +N Sbjct: 67 PGTAGPNAATVTAATPQPPAASMPPSTTTN 96 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 790,837 Number of Sequences: 2352 Number of extensions: 15690 Number of successful extensions: 24 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -