BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0448.Seq (775 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81095-2|CAB03157.1| 65|Caenorhabditis elegans Hypothetical pr... 91 6e-19 AF047660-4|AAM54169.1| 63|Caenorhabditis elegans Hypothetical ... 88 8e-18 >Z81095-2|CAB03157.1| 65|Caenorhabditis elegans Hypothetical protein F59F4.2 protein. Length = 65 Score = 91.5 bits (217), Expect = 6e-19 Identities = 39/63 (61%), Positives = 51/63 (80%) Frame = +1 Query: 64 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 243 MAPKQRM +AN+ SKN+ RGNV K+ K ED+YP APWL+ LF+FVVCGSAVF+II+ Sbjct: 1 MAPKQRMTLANKQFSKNVNNRGNVAKSLKPAEDKYPAAPWLIGLFVFVVCGSAVFEIIRY 60 Query: 244 IRL 252 +++ Sbjct: 61 VKM 63 >AF047660-4|AAM54169.1| 63|Caenorhabditis elegans Hypothetical protein T09A12.5 protein. Length = 63 Score = 87.8 bits (208), Expect = 8e-18 Identities = 37/63 (58%), Positives = 49/63 (77%) Frame = +1 Query: 64 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 243 MAPKQRM +AN SKN+T RGNVPK K E ++P + WL+ LFIFVVCGSA+F++I+ Sbjct: 1 MAPKQRMAVANAQFSKNVTQRGNVPKGNKTNESKFPTSQWLIGLFIFVVCGSAIFEVIRY 60 Query: 244 IRL 252 I++ Sbjct: 61 IKV 63 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,561,733 Number of Sequences: 27780 Number of extensions: 322911 Number of successful extensions: 763 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1861650246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -