BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0448.Seq (775 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 23 2.4 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 23 2.4 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 4.2 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 21 9.6 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 21 9.6 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 9.6 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 716 YKNYMETLTFWDYELDFP 663 Y N T+ ++DY DFP Sbjct: 288 YTNLSMTMKYYDYGADFP 305 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 716 YKNYMETLTFWDYELDFP 663 Y N T+ ++DY DFP Sbjct: 288 YTNLSMTMKYYDYGADFP 305 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.6 bits (46), Expect = 4.2 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 Query: 743 LLNINYFTLYKNYMETLTFWDYEL 672 LLNI Y+ +Y Y E + D L Sbjct: 482 LLNICYWVIYVTYQEEFKWQDSPL 505 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 770 NEFFDIY*MLLNINYFTLYKNYM 702 N + + Y N NY LYKNY+ Sbjct: 99 NNYNNNYNNNYNNNYKKLYKNYI 121 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 770 NEFFDIY*MLLNINYFTLYKNYM 702 N + + Y N NY LYKNY+ Sbjct: 99 NNYNNNYNNNYNNNYKKLYKNYI 121 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 9.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 161 SSFSLVVLGTFPLIVMFLLAISFAIRILCL 72 +S ++ +LGT+ +MF++A S IL L Sbjct: 287 TSDAVPLLGTYFNCIMFMVASSVVSTILIL 316 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,645 Number of Sequences: 438 Number of extensions: 4820 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -