BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0443.Seq (784 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F3.11 |||exopolyphosphatase |Schizosaccharomyces pombe|chr ... 27 4.0 SPBC3D6.11c |slx8||ubiquitin-protein ligase E3 Slx8 |Schizosacch... 25 9.3 >SPAC2F3.11 |||exopolyphosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 384 Score = 26.6 bits (56), Expect = 4.0 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%) Frame = +1 Query: 130 FLSGN----IDSSKLNRVHVYCLQR*FIGRL 210 F+SGN +DS + V+ YCLQR +GR+ Sbjct: 32 FVSGNESADLDSCASSIVYAYCLQRKQLGRI 62 >SPBC3D6.11c |slx8||ubiquitin-protein ligase E3 Slx8 |Schizosaccharomyces pombe|chr 2|||Manual Length = 269 Score = 25.4 bits (53), Expect = 9.3 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -1 Query: 163 STSNCQCCRRETKVSKIVCDSLYFSSLARR 74 +T C CRR+ +K++C + S ++ Sbjct: 239 ATQKCPVCRRKVHPNKVICLEMMLGSQKKK 268 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,924,481 Number of Sequences: 5004 Number of extensions: 56448 Number of successful extensions: 124 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -