BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0443.Seq (784 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1197 - 11372764-11373174 29 5.5 05_04_0277 + 19684956-19686137 28 9.6 >07_01_1197 - 11372764-11373174 Length = 136 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 181 SKHVLDSTSNCQCCRRETKVSKIVCDSLYFS 89 +K VL T++ QCC R + K++C L FS Sbjct: 105 AKDVL-RTNDLQCCSRPSSPGKLICKKLGFS 134 >05_04_0277 + 19684956-19686137 Length = 393 Score = 27.9 bits (59), Expect = 9.6 Identities = 17/30 (56%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -2 Query: 639 PELGCYLQNKSHKRNRL-GTPDSVLPRTSR 553 P L LQ S NRL GT DSVLPR +R Sbjct: 207 PNLPSTLQYLSLSANRLTGTVDSVLPRLTR 236 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,780,838 Number of Sequences: 37544 Number of extensions: 325964 Number of successful extensions: 587 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -