BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0443.Seq (784 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81583-6|CAB04674.1| 397|Caenorhabditis elegans Hypothetical pr... 30 2.1 U64835-8|AAY86281.1| 166|Caenorhabditis elegans Hypothetical pr... 29 2.8 >Z81583-6|CAB04674.1| 397|Caenorhabditis elegans Hypothetical protein T02G6.6 protein. Length = 397 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +2 Query: 473 LIKSIIMSKGQSQIFSNYNTFRKSMTQRDVRGNTESGVPRRFRLCDLFC 619 L ++II+ K Q + NY+TFR + + + + + RR D+FC Sbjct: 118 LNRNIILFKKQCKFHFNYSTFRAPFSGKSFHASRLTILRRRRASLDIFC 166 >U64835-8|AAY86281.1| 166|Caenorhabditis elegans Hypothetical protein T09D3.8 protein. Length = 166 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +3 Query: 603 CVICFVNNILIPVSGGVT*G*SAHCPHSVDTVIVTVGCCDQHTNVNTSRNVTVLVLY 773 C +C +N+IL+P G+ + T + GC + NTS + T +LY Sbjct: 64 CTVCGINDILLPADDGM----KKRPNEWLQTDSTSDGCVQWNVYCNTSPDCTSTILY 116 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,082,046 Number of Sequences: 27780 Number of extensions: 311882 Number of successful extensions: 656 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1893203640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -