BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0443.Seq (784 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 26 0.45 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 26 0.45 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 24 1.4 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 23 2.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 7.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 7.4 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 9.8 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 25.8 bits (54), Expect = 0.45 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -1 Query: 628 MLFTKQITQTKPSRYSRFSVATYITLGH*FSECIIIGKNLTLPFTHYY 485 +LFT ++ + S ++ + Y L E GKN+T P+ +YY Sbjct: 131 LLFTIELDRVLESPRGKYEFSKYDKLKKKLEEWT--GKNITTPWDYYY 176 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 25.8 bits (54), Expect = 0.45 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -1 Query: 628 MLFTKQITQTKPSRYSRFSVATYITLGH*FSECIIIGKNLTLPFTHYY 485 +LFT ++ + S ++ + Y L E GKN+T P+ +YY Sbjct: 146 LLFTIELDRVLESPRGKYEFSKYDKLKKKLEEWT--GKNITTPWDYYY 191 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 406 NIDFIIYLIVINYFRPCAI 462 N DFIIY + +++ PC I Sbjct: 340 NTDFIIYSSLSSFYIPCII 358 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 23.4 bits (48), Expect = 2.4 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -1 Query: 622 FTKQITQTKPSRYSRFSVATYITLGH*FSECIIIGKNLTLPFTHYY 485 FT ++ + S ++ + Y L E GKN+T P+ +YY Sbjct: 36 FTIELDKVLESPRGKYEFSKYDKLKKKLEEWT--GKNITTPWDYYY 79 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 177 NMYSIQLRTVNVAGEKPKFPRLSV 106 N Y + L + N G P P LSV Sbjct: 1469 NTYQLYLTSHNKIGSSPSSPVLSV 1492 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 177 NMYSIQLRTVNVAGEKPKFPRLSV 106 N Y + L + N G P P LSV Sbjct: 1465 NTYQLYLTSHNKIGSSPSSPVLSV 1488 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +1 Query: 130 FLSGNIDSSKLN 165 +L G+IDSSK+N Sbjct: 507 YLYGSIDSSKIN 518 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,439 Number of Sequences: 438 Number of extensions: 3825 Number of successful extensions: 19 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -