BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0434.Seq (782 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0644 + 16527364-16527961,16528048-16528622,16528710-16528877 29 5.5 03_04_0125 - 17487746-17487847,17488025-17488555,17488834-174891... 29 5.5 >05_03_0644 + 16527364-16527961,16528048-16528622,16528710-16528877 Length = 446 Score = 28.7 bits (61), Expect = 5.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 561 HFSGSGLHILCAYACRHG 508 H+ G G+H++C Y C HG Sbjct: 11 HYGGGGIHLVCEY-CGHG 27 >03_04_0125 - 17487746-17487847,17488025-17488555,17488834-17489102, 17489161-17489257,17491060-17491161,17491235-17491367, 17491589-17491681,17491756-17491844,17493578-17493700, 17496908-17497004,17497440-17497639 Length = 611 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -2 Query: 286 MNMKSKIIRELRLLFYYSHSPSSVLTNSSGINE 188 +N ++ EL ++FYYS S+++ N S INE Sbjct: 151 LNFFLEVELELWIIFYYSFGCSTLIPNHSEINE 183 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,228,904 Number of Sequences: 37544 Number of extensions: 431163 Number of successful extensions: 1144 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1143 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -