BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0430.Seq (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 90 2e-18 SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 89 3e-18 SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 56 2e-08 SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 49 3e-06 SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) 33 0.29 SB_26353| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.9e-18) 31 0.67 SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) 30 1.5 SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) 30 1.5 SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) 29 4.7 SB_48991| Best HMM Match : Rad52_Rad22 (HMM E-Value=5.2e-12) 28 6.2 SB_3503| Best HMM Match : Rad52_Rad22 (HMM E-Value=1e-24) 28 6.2 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) 28 6.2 SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) 28 8.2 SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) 28 8.2 SB_24839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_3| Best HMM Match : Peptidase_C21 (HMM E-Value=5) 28 8.2 >SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 969 Score = 89.8 bits (213), Expect = 2e-18 Identities = 37/60 (61%), Positives = 48/60 (80%) Frame = +3 Query: 510 LSSLEGELKGTFYPLTGM*KETQQQLIDDHFLFKEGDRFLQAANACSFWPNGRGIYHNEN 689 L+SL G+L G +YPL+GM + T+QQL+DDHFLFK+GDRFL+AA WP GRGI+HN + Sbjct: 768 LNSLTGDLAGKYYPLSGMDEATRQQLVDDHFLFKKGDRFLEAAGVNKMWPEGRGIFHNND 827 Score = 76.6 bits (180), Expect = 2e-14 Identities = 40/79 (50%), Positives = 50/79 (63%) Frame = +2 Query: 17 DGCSSARKAATMVDAATLEKLEAGFSKLQGSDSKSLLKKYLTKEVFDSLKNKKTSFGSTL 196 D + +K + AA K L+ + KSL+KKYLT+E+F+ LK+KKT G TL Sbjct: 171 DMYNGVKKLLEIEKAAVEAKRNVFPEVLKKPEVKSLMKKYLTEEMFNELKDKKTELGVTL 230 Query: 197 LDCIQSGVENLDSGVGIYA 253 DCI SGVENLDSG GIYA Sbjct: 231 SDCINSGVENLDSGTGIYA 249 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/68 (55%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Frame = +2 Query: 53 VDAATLEKLEAGFSK-LQGSDSKSLLKKYLTKEVFDSLKNKKTSFGSTLLDCIQSGVENL 229 ++ A +E+ F + L+ + KSLLKKYLT++VF+SLK KKTS G+ L DCI SGV NL Sbjct: 614 IERAAIEEAHLKFPEDLKKPEVKSLLKKYLTEDVFNSLKEKKTSRGAGLYDCINSGVVNL 673 Query: 230 DSGVGIYA 253 DSG G+YA Sbjct: 674 DSGTGVYA 681 Score = 76.2 bits (179), Expect = 2e-14 Identities = 37/82 (45%), Positives = 49/82 (59%) Frame = +1 Query: 256 DAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRS 435 D ESY +FA LFD IIEDYH +K KH + +LDP G F+ STR+R R+ Sbjct: 251 DEESYKLFAPLFDKIIEDYHAPYKLEQKHTSDMNPEKVEAPDLDPEGSFIRSTRIRVARN 310 Query: 436 LEGYPFNPCLTESQYKEMEDKV 501 L+GY P L++ E+E+KV Sbjct: 311 LKGYALTPALSKKARLEIEEKV 332 Score = 75.8 bits (178), Expect = 3e-14 Identities = 38/85 (44%), Positives = 48/85 (56%) Frame = +1 Query: 253 ADAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGR 432 AD E Y VF ELFD IIEDYH +K + H + NLD G F+ STR+R R Sbjct: 682 ADEECYEVFGELFDKIIEDYHAPYKLEENHKSDMDPEKVDAPNLDAEGAFIRSTRIRVAR 741 Query: 433 SLEGYPFNPCLTESQYKEMEDKVSG 507 +L+GY P LT + ++E KV G Sbjct: 742 NLKGYALTPGLTRKERVDVESKVVG 766 Score = 65.7 bits (153), Expect = 3e-11 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +3 Query: 561 M*KETQQQLIDDHFLFKEGDRFLQAANACSFWPNGRGIYHNEN 689 M + T+QQL+DDHFLFK+GDRFL+AA WP GRGI+HN + Sbjct: 1 MDEATRQQLVDDHFLFKKGDRFLEAAGVNREWPEGRGIFHNND 43 Score = 48.8 bits (111), Expect = 4e-06 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = +3 Query: 516 SLEGELKGTFYPLTGM*KETQQQLIDDHFLFKE 614 SL G+L G ++PL GM +ET+QQL++DHFLFK+ Sbjct: 338 SLTGDLAGKYHPLDGMTEETRQQLVNDHFLFKK 370 Score = 41.5 bits (93), Expect = 6e-04 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +3 Query: 507 HLSSLEGELKGTFYPLTGM*KETQQQLIDDHFLFKE-GDRFLQAANACSFWPNGRGIYHN 683 H ++L G++ P K + + F+ + GDRFL+AA WP GRGI+HN Sbjct: 415 HAANLRGKIFSK-KPTVDRRKNNDFAMKNSQFVSRHSGDRFLEAAGVNKLWPEGRGIFHN 473 Query: 684 EN 689 + Sbjct: 474 ND 475 >SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 725 Score = 89.0 bits (211), Expect = 3e-18 Identities = 37/60 (61%), Positives = 47/60 (78%) Frame = +3 Query: 510 LSSLEGELKGTFYPLTGM*KETQQQLIDDHFLFKEGDRFLQAANACSFWPNGRGIYHNEN 689 L SL G+L G +YPLTGM + T+Q+L+DDHFLFK+GDRFL+AA WP GRGI+HN + Sbjct: 523 LCSLTGDLAGKYYPLTGMDEATRQKLVDDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNND 582 Score = 80.6 bits (190), Expect = 1e-15 Identities = 39/83 (46%), Positives = 51/83 (61%) Frame = +1 Query: 256 DAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRS 435 D ESYS+F+ LFD I+E YH +K DKH + T NLDP G F+ STR+R R+ Sbjct: 438 DEESYSLFSPLFDKIVEHYHAPYKLADKHTSDMNPEKVTAPNLDPDGVFIRSTRIRVARN 497 Query: 436 LEGYPFNPCLTESQYKEMEDKVS 504 L+GY P LT + E+E KV+ Sbjct: 498 LKGYALTPGLTRKERNEIEKKVT 520 Score = 78.2 bits (184), Expect = 6e-15 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +3 Query: 528 ELKGTFYPLTGM*KETQQQLIDDHFLFKEGDRFLQAANACSFWPNGRGIYHN 683 +L G +YPLTGM + T++QL++DHFLFK+GDRFL AA WP GRGI+HN Sbjct: 150 DLAGKYYPLTGMDEVTREQLVNDHFLFKKGDRFLDAAGCNKEWPEGRGIFHN 201 Score = 74.9 bits (176), Expect = 5e-14 Identities = 38/73 (52%), Positives = 51/73 (69%), Gaps = 1/73 (1%) Frame = +2 Query: 38 KAATMVDAATLEKLEAGFSK-LQGSDSKSLLKKYLTKEVFDSLKNKKTSFGSTLLDCIQS 214 K+ ++ A +EK + F + L + KSLLKKYLT E+F+SLK+KKT+ G +L DCI S Sbjct: 337 KSLLEIERAAIEKQRSVFPEALNKEECKSLLKKYLTAEMFNSLKDKKTAKGISLYDCINS 396 Query: 215 GVENLDSGVGIYA 253 GV NLDS G+YA Sbjct: 397 GVVNLDSSCGVYA 409 Score = 64.1 bits (149), Expect = 1e-10 Identities = 33/67 (49%), Positives = 40/67 (59%), Gaps = 2/67 (2%) Frame = +1 Query: 256 DAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRS 435 D ESY+VFA LFD +IEDYH+ +K D H D +LDP F+ STR+R GR Sbjct: 91 DEESYTVFAPLFDKVIEDYHSPYKLKDGHTSDMNPDRVNAPDLDPDNRFIRSTRIRVGRD 150 Query: 436 LEG--YP 450 L G YP Sbjct: 151 LAGKYYP 157 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/51 (47%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +2 Query: 50 MVDAATLEKLEAGFS-----KLQGSDSKSLLKKYLTKEVFDSLKNKKTSFG 187 M DAA EK + + K + K LLKKYLT +VFD LK KKT G Sbjct: 8 MADAAEAEKYRSKNAYPVPLKSAKCNPKCLLKKYLTNQVFDQLKTKKTKRG 58 >SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 79.8 bits (188), Expect = 2e-15 Identities = 39/83 (46%), Positives = 51/83 (61%) Frame = +1 Query: 256 DAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRS 435 D ESY+VFA LFD +IEDYH+ +K D H D +LDP F+ STR+R GR+ Sbjct: 230 DEESYTVFAPLFDKVIEDYHSPYKLKDGHTSDMNPDRVNAPDLDPDNRFIRSTRIRVGRN 289 Query: 436 LEGYPFNPCLTESQYKEMEDKVS 504 L+GY P LT+ + E+E K S Sbjct: 290 LKGYGLAPSLTKKERVELEKKAS 312 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +2 Query: 116 KSLLKKYLTKEVFDSLKNKKTSFG 187 K LLKKYLT +VFD LK KKT G Sbjct: 174 KCLLKKYLTNQVFDQLKTKKTKRG 197 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/79 (45%), Positives = 50/79 (63%) Frame = +1 Query: 256 DAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRS 435 D ESY FAELFDP+IE+ H+GFKK+DKH G D ++V+S+RVR GRS Sbjct: 111 DEESYDTFAELFDPVIEERHSGFKKSDKHKTDLDSSKIRGGKFDE--KYVLSSRVRTGRS 168 Query: 436 LEGYPFNPCLTESQYKEME 492 + G+ P T ++ +E+E Sbjct: 169 IRGFSLPPHCTRAERREVE 187 Score = 64.5 bits (150), Expect = 8e-11 Identities = 31/61 (50%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Frame = +3 Query: 510 LSSLEGELKGTFYPLTGM*KETQQQLIDDHFLF-KEGDRFLQAANACSFWPNGRGIYHNE 686 L L G+L G +YPL GM QQQLIDDHFLF K L A WP+ RGI+HN+ Sbjct: 194 LDGLGGDLNGKYYPLNGMSDAQQQQLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHND 253 Query: 687 N 689 + Sbjct: 254 S 254 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +2 Query: 119 SLLKKYLTKEVFDSLKNKKTSFGSTLLDCIQSGVEN 226 +L+ K+LT ++ L++K T G TL IQ+GV+N Sbjct: 61 NLMAKHLTPRLYVKLRDKSTPNGYTLDQAIQTGVDN 96 >SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 71.7 bits (168), Expect = 5e-13 Identities = 37/82 (45%), Positives = 50/82 (60%) Frame = +1 Query: 256 DAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRS 435 D ESY VFA+LFDP+IE+ HNG+KKTDKH G+ D +V+STR R GRS Sbjct: 452 DEESYDVFADLFDPVIEERHNGYKKTDKHVTDLNHRKLKGGSFDE--RYVLSTRCRTGRS 509 Query: 436 LEGYPFNPCLTESQYKEMEDKV 501 + G+ P T ++ + +E V Sbjct: 510 IRGFSLPPHCTRAERRSVEKVV 531 Score = 64.1 bits (149), Expect = 1e-10 Identities = 31/61 (50%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = +3 Query: 510 LSSLEGELKGTFYPLTGM*KETQQQLIDDHFLF-KEGDRFLQAANACSFWPNGRGIYHNE 686 L L G+L GT+YPL M E Q+QLI+DHFLF K L A WP+ RGI+HN+ Sbjct: 535 LDQLGGDLSGTYYPLGKMTNEEQEQLINDHFLFDKPVSPLLTCAGMARDWPDARGIWHNK 594 Query: 687 N 689 N Sbjct: 595 N 595 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 125 LKKYLTKEVFDSLKNKKTSFGSTLLDCIQSGVEN 226 + ++L+ ++ LK+K T G TL IQ+GV+N Sbjct: 404 MARHLSPRLYTKLKDKVTPNGYTLDMAIQTGVDN 437 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 70.9 bits (166), Expect = 9e-13 Identities = 39/83 (46%), Positives = 53/83 (63%) Frame = +1 Query: 256 DAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRS 435 D ESY VFAEL DP+IE H G+KKTDKH D G LDP ++V+S+RVR GRS Sbjct: 2371 DEESYDVFAELLDPVIELRHGGYKKTDKHKTDLNPDNLKGGALDP--KYVLSSRVRTGRS 2428 Query: 436 LEGYPFNPCLTESQYKEMEDKVS 504 + G+ P + ++ + +E K+S Sbjct: 2429 IRGFCLPPHCSRAERRSVE-KIS 2450 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = +3 Query: 510 LSSLEGELKGTFYPLTGM*KETQQQLIDDHFLF-KEGDRFLQAANACSFWPNGRGIYHNE 686 L+ L+GE KG +YPL M E Q+QLI+DHFLF K L A WP+ RGI+HNE Sbjct: 2454 LAKLDGEFKGKYYPLNKMTDEEQEQLINDHFLFDKPVSPLLTCAGMARDWPDARGIWHNE 2513 Query: 687 N 689 N Sbjct: 2514 N 2514 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/34 (52%), Positives = 25/34 (73%) Frame = +2 Query: 125 LKKYLTKEVFDSLKNKKTSFGSTLLDCIQSGVEN 226 + K LTKE++ SL++K T G TL D IQ+GV+N Sbjct: 2323 MAKVLTKEIYRSLRDKSTKNGFTLDDIIQTGVDN 2356 >SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1115 Score = 70.1 bits (164), Expect = 2e-12 Identities = 35/83 (42%), Positives = 52/83 (62%) Frame = +1 Query: 256 DAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRS 435 D ESY VFA++FDP+IE HNG+KKT KH + + +G D ++V+S RVR GRS Sbjct: 418 DEESYDVFADMFDPVIEKRHNGYKKTAKH-KTDLNPSNLIGGDDLDEKYVLSCRVRTGRS 476 Query: 436 LEGYPFNPCLTESQYKEMEDKVS 504 + G P + ++ +E+E V+ Sbjct: 477 IRGLCLPPWCSRAERREVEKIVT 499 Score = 68.9 bits (161), Expect = 4e-12 Identities = 37/83 (44%), Positives = 52/83 (62%) Frame = +1 Query: 256 DAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRS 435 D ESY VFA++FDP+IE H+G++KTD H D +G D ++V+S RVR GRS Sbjct: 49 DEESYDVFADMFDPVIEKRHDGYRKTDMHKTDLNPD-HLIGGDDLDEKYVLSCRVRTGRS 107 Query: 436 LEGYPFNPCLTESQYKEMEDKVS 504 + G P T ++ +E+E KVS Sbjct: 108 IRGLGLPPHCTRAERREVE-KVS 129 Score = 68.1 bits (159), Expect = 6e-12 Identities = 37/85 (43%), Positives = 47/85 (55%), Gaps = 1/85 (1%) Frame = +3 Query: 438 RGVPLQPLPHRVPVQGDGGQGLRHLSSLEGELKGTFYPLTGM*KETQQQLIDDHFLF-KE 614 RG+ L P R + + L SL+GE KG +YPL+ M Q QLIDDHFLF K Sbjct: 109 RGLGLPPHCTRAERREVEKVSVEALDSLDGEFKGKYYPLSNMTAAEQDQLIDDHFLFDKP 168 Query: 615 GDRFLQAANACSFWPNGRGIYHNEN 689 L A+ WP+ RGI+HN+N Sbjct: 169 VSPLLLASRMARDWPDARGIWHNDN 193 Score = 62.1 bits (144), Expect = 4e-10 Identities = 34/79 (43%), Positives = 45/79 (56%) Frame = +1 Query: 256 DAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRS 435 D E+Y VFA L DP+IE HNG+ K KH D + +G D FV+S RVR GRS Sbjct: 815 DEETYKVFAALLDPVIEARHNGYLKGAKHVTDLNPD-NLVGGDDLDANFVLSCRVRTGRS 873 Query: 436 LEGYPFNPCLTESQYKEME 492 + G P T ++ +E+E Sbjct: 874 IRGLGLPPHCTRAERREVE 892 Score = 61.3 bits (142), Expect = 7e-10 Identities = 29/60 (48%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +3 Query: 510 LSSLEGELKGTFYPLTGM*KETQQQLIDDHFLF-KEGDRFLQAANACSFWPNGRGIYHNE 686 L++L+G LKG +YPL+ M Q+QLI+DHFLF K L +A WP+ RGI+HN+ Sbjct: 899 LATLDGPLKGKYYPLSKMTDAEQEQLINDHFLFDKPVSPLLLSARMARDWPDARGIWHND 958 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/61 (47%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Frame = +3 Query: 510 LSSLEGELKGTFYPLTGM*KETQQQLIDDHFLF-KEGDRFLQAANACSFWPNGRGIYHNE 686 L+ L+G L G +Y L M + Q QLIDDHFLF K L A+ WP+ RGI+HN+ Sbjct: 502 LAELDGPLAGKYYSLMTMTEAEQDQLIDDHFLFDKPVSPLLLASRMARDWPDARGIWHND 561 Query: 687 N 689 N Sbjct: 562 N 562 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +2 Query: 17 DGCSSARKAATMVDAATLEKLEAGFSKLQGSD-SKSLLKKYLTKEVFDSLKNKKTSFGST 193 + S AR+ A +A +K + ++ G + ++ + K+LT++V++ L N KT G T Sbjct: 731 ESVSKAREEAIKKEAER-QKASSTLRRVPGPEQAQHYMAKFLTRDVYNKLCNLKTPSGFT 789 Query: 194 LLDCIQSGVEN 226 L IQ+GV+N Sbjct: 790 LDGVIQTGVDN 800 Score = 32.3 bits (70), Expect = 0.38 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 125 LKKYLTKEVFDSLKNKKTSFGSTLLDCIQSGVEN 226 + K +TK+V+ L N +T G TL IQ+GV+N Sbjct: 1 MAKCMTKDVYQRLSNLRTPSGYTLDMAIQTGVDN 34 >SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 309 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/57 (45%), Positives = 35/57 (61%) Frame = +3 Query: 516 SLEGELKGTFYPLTGM*KETQQQLIDDHFLFKEGDRFLQAANACSFWPNGRGIYHNE 686 SL +L G Y T M E +Q+L+DDHFLF+ D+ A+ FWP GRGI+ N+ Sbjct: 95 SLGDDLAGNLYRHTTMTDEERQKLVDDHFLFRGKDKMQAASGYHEFWPEGRGIFINK 151 Score = 48.4 bits (110), Expect = 5e-06 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +1 Query: 256 DAESYSVFAELFDPIIEDYHNGFK-KTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGR 432 D ESY F + + P+I+ YH GF T KH + + D A ++STR+R R Sbjct: 7 DKESYDDFKDFYYPVIQAYHKGFDINTSKHVTDMDPEKISTELSDSAKAKIISTRIRVAR 66 Query: 433 SLEGYPFNP 459 +L +P NP Sbjct: 67 NLSMFPLNP 75 >SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 383 Score = 49.2 bits (112), Expect = 3e-06 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +1 Query: 232 LRRRYLRADAESYSVFAELFDPIIEDYHNGFK-KTDKHPPKNWGDVDTLGNLDPAGEFVV 408 L R D ESY F + + P+I+ YH GF T KH + + D A ++ Sbjct: 91 LARAINTGDKESYDDFKDFYYPVIQAYHKGFDINTSKHVTDMDPEKISTELSDSAKAKII 150 Query: 409 STRVRCGRSLEGYPFNP 459 STR+R R+L +P NP Sbjct: 151 STRIRVARNLSMFPLNP 167 Score = 35.9 bits (79), Expect = 0.031 Identities = 20/49 (40%), Positives = 26/49 (53%) Frame = +3 Query: 516 SLEGELKGTFYPLTGM*KETQQQLIDDHFLFKEGDRFLQAANACSFWPN 662 SL +L G Y T M E +Q+L+DDHFLF+ F+ A W N Sbjct: 187 SLGDDLAGNLYRHTTMTDEERQKLVDDHFLFR-SRVFINKAKTFLNWIN 234 >SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) Length = 132 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +2 Query: 119 SLLKKYLTKEVFDSLKNKKTSFGSTLLDCIQSGVEN 226 +++ ++LT E++ L ++KTS G TL IQ GV+N Sbjct: 77 NIMARHLTPEMYVHLCDRKTSNGFTLDQAIQPGVDN 112 >SB_26353| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.9e-18) Length = 138 Score = 31.5 bits (68), Expect = 0.67 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 528 ELKGTFYPLTGM*KETQQQLIDDHFLFKEGDRFLQAANACSF-WPNGRGIYHNEN 689 E +G +Y L+ M + L +H L L ++ S WP+GRG++H ++ Sbjct: 2 EFEGRYYALSSMTPQDYHHLSLEHVLSDATKHPLIVSSGMSRDWPDGRGVWHTKD 56 >SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) Length = 490 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +1 Query: 364 VDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDKV 501 V G LD VVS RVR RSL+G+PF + ++ +E+++ V Sbjct: 279 VGVTGTLDA---HVVSCRVRVVRSLQGFPFAWVCSPNERREIQNVV 321 >SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) Length = 322 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +1 Query: 364 VDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDKV 501 V G LD VVS RVR RSL+G+PF + ++ +E+++ V Sbjct: 270 VGVTGTLDA---HVVSCRVRVVRSLQGFPFAWVCSPNERREIQNVV 312 >SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) Length = 385 Score = 28.7 bits (61), Expect = 4.7 Identities = 21/65 (32%), Positives = 31/65 (47%) Frame = +2 Query: 38 KAATMVDAATLEKLEAGFSKLQGSDSKSLLKKYLTKEVFDSLKNKKTSFGSTLLDCIQSG 217 KAA + + L KL AG++ L D+ L + LT E LK K S + +Q Sbjct: 195 KAAVQLLKSVLPKLTAGYADLYHGDA---LVEVLTTEWHGDLKEKYPQDVSGIYQLVQGQ 251 Query: 218 VENLD 232 +E+ D Sbjct: 252 LESRD 256 >SB_48991| Best HMM Match : Rad52_Rad22 (HMM E-Value=5.2e-12) Length = 353 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 80 EAGFSKLQGSDSKSL-LKKYLTKEVFDSLKNKKTSFGSTLLDCI 208 + G+ +G SK+L L+K + V D LK +FG L +C+ Sbjct: 30 DVGYGVSEGMKSKALSLEKARKEAVTDGLKRALKNFGQALGNCV 73 >SB_3503| Best HMM Match : Rad52_Rad22 (HMM E-Value=1e-24) Length = 398 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 80 EAGFSKLQGSDSKSL-LKKYLTKEVFDSLKNKKTSFGSTLLDCI 208 + G+ +G SK+L L+K + V D LK +FG L +C+ Sbjct: 75 DVGYGVSEGMKSKALSLEKARKEAVTDGLKRALKNFGQALGNCV 118 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 452 KGYPSSERPQRTRVETTNS-PAGSRLPSVSTSP 357 +G SSERP+R+R T + P S LP +++P Sbjct: 1178 RGSLSSERPERSRRRRTETEPRDSSLPCTASTP 1210 >SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) Length = 362 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 243 PTPESKFSTPDWMQSRRVDPNEVFLFFRLSNTS 145 P P+ KFS P + SR +D E L F L+ S Sbjct: 5 PKPKEKFSEPVIIASRNLDSVEARLAFNLTTVS 37 >SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) Length = 809 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 204 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 91 Q R D N V++ +R L F DL+ PWS+L Sbjct: 65 QDRAADKNHVYISYR-DCKKLDEEAFPEDLDEAPWSVL 101 >SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) Length = 617 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 15 LTVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLS 119 LT V+VP+ Q +T RN + S+S+ DP L+ Sbjct: 534 LTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLT 568 >SB_24839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 15 LTVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLS 119 LT V+VP+ Q +T RN + S+S+ DP L+ Sbjct: 70 LTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLT 104 >SB_3| Best HMM Match : Peptidase_C21 (HMM E-Value=5) Length = 186 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 265 SYSVFAELFDPIIEDYHNGFKKTDKHPPKNW-GDVDT 372 +Y + F+P +DY NG++ TD H W G++ T Sbjct: 89 TYEQISITFEPY-QDYANGYRATDLHGKVAWVGELST 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,211,864 Number of Sequences: 59808 Number of extensions: 375164 Number of successful extensions: 1458 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1442 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -