BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0425.Seq (712 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 29 2.3 At4g04910.1 68417.m00714 AAA-type ATPase family protein similar ... 29 4.0 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 29 4.0 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 29 4.0 At4g38560.1 68417.m05459 expressed protein 28 7.0 At3g05660.1 68416.m00630 disease resistance family protein conta... 28 7.0 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -2 Query: 270 QKLSRSSKLT-TSDARPSVDWF*SNKSTHPITGQSSD 163 Q L S L+ S RPS+DWF N+S + + SS+ Sbjct: 218 QALVSDSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At4g04910.1 68417.m00714 AAA-type ATPase family protein similar to SP|P18708 Vesicular-fusion protein NSF (N-ethylmaleimide-sensitive fusion protein) (NEM-sensitive fusion protein) {Cricetulus griseus}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain; contains non-consensus AT-AC splice sites at intron 2 Length = 742 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = +2 Query: 203 DQNQSTEGLASE--VVNFDDLDNFCRSHG 283 +Q+Q T G ASE V+ FD++D C+S G Sbjct: 307 EQDQRTLGDASELHVIIFDEIDAICKSRG 335 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -3 Query: 440 RLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAE 339 RLLPSL VV+ +P+ + P S LP + + V E Sbjct: 84 RLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLE 117 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 431 PSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 324 PS A + APSP +NP P T V++ ES Sbjct: 39 PSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTES 74 >At4g38560.1 68417.m05459 expressed protein Length = 521 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 10 SYMLVSKIKPCMSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILEL 153 SY + + + + + GD A+GS Q +SYS+ + V+LEL Sbjct: 341 SYKVRASVSSTLQKILDKHGDIASGSKLQSLRTKSYSLETLAAVVLEL 388 >At3g05660.1 68416.m00630 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 883 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 191 VLLLDQNQSTEGLASEVVNFDDLDNFCRSHGQVPATHLSNV 313 +L LD N+ + L EV+N L SH Q T N+ Sbjct: 211 ILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNI 251 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,222,207 Number of Sequences: 28952 Number of extensions: 311415 Number of successful extensions: 729 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -