BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0418.Seq (784 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0598 - 4443474-4443917 28 7.3 07_01_0130 - 963856-965454 28 7.3 >07_01_0598 - 4443474-4443917 Length = 147 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -1 Query: 523 LHSWW-ALPSIPLSFSFATILPPESKIFGFPEAARRAIV 410 + SW A+P+ P AT LPP G P+AAR A+V Sbjct: 24 MESWMVAVPAAP-----ATPLPPHEPSTGAPDAARAAVV 57 >07_01_0130 - 963856-965454 Length = 532 Score = 28.3 bits (60), Expect = 7.3 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -2 Query: 645 HQLRTAMHHHPPNQERAVNLSILPVSGPGEISR 547 H + + PPN NL +LP+ GP ++ + Sbjct: 195 HIINFLLRPEPPNTLSVDNLGVLPIIGPAKVGK 227 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,042,474 Number of Sequences: 37544 Number of extensions: 531252 Number of successful extensions: 1317 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1317 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -