BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0409.Seq (734 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 25 0.84 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 23 1.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.6 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 24.6 bits (51), Expect = 0.84 Identities = 14/57 (24%), Positives = 24/57 (42%) Frame = +3 Query: 153 NVVDGAIVPDTSLKPILTICWE*CPRATYINEHKSQKNTDLWTATMPSTIFQKIDHH 323 N GA PD + + W + H+SQ + D+ A S + + +D+H Sbjct: 84 NKQSGAAAPDARTQRV----WSQYNFTNNVLVHRSQNSNDVCLAIPESLVIKLVDYH 136 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 613 HNKLLIKFHIIYLNRIF 663 HN + +K +IY NRIF Sbjct: 139 HNLIRLKNCVIYFNRIF 155 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 187 DVSGTIAPSTTLSRPARSTSTESN 116 D S T+APSTT P + +T ++ Sbjct: 2287 DASSTMAPSTTPMVPDKPVTTTTS 2310 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,628 Number of Sequences: 336 Number of extensions: 3340 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -