BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0408.Seq (735 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_6822| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_40386| Best HMM Match : BAR (HMM E-Value=0) 31 1.3 SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) 30 1.7 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 30 1.7 SB_36488| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_41| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_21505| Best HMM Match : Topoisom_I (HMM E-Value=9.90001e-40) 29 3.9 SB_54| Best HMM Match : Actin (HMM E-Value=0) 29 3.9 SB_52343| Best HMM Match : OTU (HMM E-Value=0.0036) 29 3.9 SB_15732| Best HMM Match : DltD_N (HMM E-Value=8.6) 28 6.8 SB_10611| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_40359| Best HMM Match : PSCyt3 (HMM E-Value=9.6) 28 6.8 SB_40118| Best HMM Match : DREPP (HMM E-Value=0.085) 28 6.8 SB_19128| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_47094| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_22747| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) 28 9.0 SB_7420| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 28 9.0 SB_53672| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_42361| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_32577| Best HMM Match : PH (HMM E-Value=7e-17) 28 9.0 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/24 (62%), Positives = 20/24 (83%) Frame = +3 Query: 438 IEEKRQRLEEAEKKRQAMLQAMKE 509 +EE+R+RLE EK+RQA QAM+E Sbjct: 319 LEEERKRLENLEKERQAAQQAMQE 342 >SB_6822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 31.1 bits (67), Expect = 0.97 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 178 PKQEGEGDPEFIKRQDQKRSDLDEQLRNTSTNGANSGPRRRMSSNALKRSRPSAR 342 P+++ D R+D KRSD + LR + +N+ PRR S+++ S R Sbjct: 705 PRRDKRSDSNATPRRD-KRSDSNATLRRDKKSDSNATPRRDEKSDSITSSSHETR 758 >SB_40386| Best HMM Match : BAR (HMM E-Value=0) Length = 369 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 175 APKQEGEGDPEFIKRQDQKRSDLDEQLRNTSTNGANSGPRRRMS-SNALKRS 327 APKQ E +PE + Q +K + DE+ N T+ + P + S S+ LK S Sbjct: 256 APKQAPE-EPENVPEQHEKAPESDEEQGNGETSAKGTNPLAKSSDSDKLKPS 306 >SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) Length = 1078 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +3 Query: 441 EEKRQRLEEAEKKRQAMLQAMKEPARPDPTSPSKRR 548 EE+RQ+ EEA K+R+ L A K P +S +RR Sbjct: 537 EERRQKREEARKRREEKL-AKKGPTTSTSSSRKRRR 571 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +3 Query: 441 EEKRQRLEEAEKKRQAMLQAMKEPARPDPTSPSKRRA 551 EE+RQ+ EEA K+R+ L A KE ++ SK R+ Sbjct: 1344 EERRQKREEARKRREEKL-AKKESSKSSNKRKSKERS 1379 >SB_36488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +1 Query: 184 QEGEGDPEFIKRQDQKRSDLDEQLRNTSTNGANSGPRRRMSSNALKR 324 ++G+ D E+ +Q+ E+LRNT N G R+ + S A ++ Sbjct: 67 RKGQKDSEYELDDEQRARKESEKLRNTQRPACNDGRRQLVCSKAKRK 113 >SB_41| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = -2 Query: 695 GPSVGVCRRRDPRWSAA*CGWTERFSSPLPAAPWSCCAPAGHC 567 G V C R D A CG T ++S P +CCA A C Sbjct: 173 GQDVNRCHR-DAAIVAKGCGCTGQYSQTCTQGPGACCATAESC 214 >SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2806 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 208 FIKRQDQKRSDLDEQLRNTSTNGANSGPRRRMSSNALKRSRPSA 339 F KRQ QK S L + + G + G R S + K+ RP + Sbjct: 2535 FEKRQLQKPSSLQQSKKKDDPAGGSHGKNRSTSFSGEKKKRPKS 2578 >SB_21505| Best HMM Match : Topoisom_I (HMM E-Value=9.90001e-40) Length = 372 Score = 29.1 bits (62), Expect = 3.9 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 4/71 (5%) Frame = +2 Query: 527 NFTIQKKSENFGLSNAQLERNKTKEQLEEEKKISLSIRIKPLTIEGLS----VDKLRQKA 694 N T K E +SN QL+ + K+ ++E KK ++R+K + S V+K + + Sbjct: 172 NRTAPKTFEK-SMSNLQLKISDKKKTVKEAKKELKALRVKAKESKSESNNKAVEKKKAQV 230 Query: 695 QELWECIVKLE 727 Q L E + KLE Sbjct: 231 QRLEEQLFKLE 241 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 29.1 bits (62), Expect = 3.9 Identities = 20/56 (35%), Positives = 24/56 (42%) Frame = +1 Query: 187 EGEGDPEFIKRQDQKRSDLDEQLRNTSTNGANSGPRRRMSSNALKRSRPSARFLVP 354 E E DP+ R RS+ NT N AN+GP SSN P+ R P Sbjct: 984 EIECDPDVAMRLATLRSEAS--FENTLNNQANAGPSEETSSNPKSYLVPAPRKAKP 1037 >SB_52343| Best HMM Match : OTU (HMM E-Value=0.0036) Length = 1014 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +3 Query: 471 EKKRQAMLQAMKEPARPDPTSPSKRRAKTSV*AMPSW 581 +K +++ +EPA P SP+++R K S A+ +W Sbjct: 886 DKPVDEIVEEPEEPADPSAASPARKRRKRSSFALGAW 922 >SB_15732| Best HMM Match : DltD_N (HMM E-Value=8.6) Length = 121 Score = 28.3 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 483 QAMLQAMKEPARPDPTSPSKRRAKTS 560 Q L++M+ P+ P TSP+KRR S Sbjct: 93 QTSLESMRAPSCPTTTSPAKRRRTPS 118 >SB_10611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1134 Score = 28.3 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 483 QAMLQAMKEPARPDPTSPSKRRAKTS 560 Q L++M+ P+ P TSP+KRR S Sbjct: 839 QTSLESMRPPSCPTTTSPAKRRRTPS 864 >SB_40359| Best HMM Match : PSCyt3 (HMM E-Value=9.6) Length = 121 Score = 28.3 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 483 QAMLQAMKEPARPDPTSPSKRRAKTS 560 Q L++M+ P+ P TSP+KRR S Sbjct: 93 QTTLESMRAPSCPTTTSPAKRRRTPS 118 >SB_40118| Best HMM Match : DREPP (HMM E-Value=0.085) Length = 512 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +2 Query: 569 NAQLERNKTKEQLEEEKKISLSIRIKPLTIEGLSVDKLRQKAQELWECIVKLETE 733 N ++E K + QL + K I+ L+ D+L++ QEL E + LETE Sbjct: 131 NQEMEIQKLRSQLGQVSSSYRESEKKSAEIQTLN-DELQRNIQELTERVATLETE 184 >SB_19128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 28.3 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 483 QAMLQAMKEPARPDPTSPSKRRAKTS 560 Q L++M+ P+ P TSP+KRR S Sbjct: 93 QTSLESMRAPSCPTTTSPAKRRRTPS 118 >SB_47094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 512 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 441 EEKRQRLEEAEKKRQAMLQAMKEPARPDPT 530 EEK+++ EAE R+A +QA E + PT Sbjct: 49 EEKKRQQAEAEAARRARIQARLEESTKKPT 78 >SB_22747| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) Length = 337 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 372 RGAFLLRHEKPCAWPASL*GV 310 RGA L R+E PC W A L G+ Sbjct: 69 RGAALQRNEPPCMWIAILNGI 89 >SB_7420| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 1354 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 462 EEAEKKRQAMLQAMKEPARPDPTSPSKRRAK 554 EE K +A+ K PA P PT PS+ R++ Sbjct: 1162 EEKTKSTEAVSPKPKRPAPPRPTVPSQGRSE 1192 >SB_53672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 524 PNFTIQKKSENFGLSNAQLERNKTKEQLEEE 616 P T + EN GLSN L ++KTK E+ Sbjct: 498 PTPTSSQTQENIGLSNGTLTQDKTKPGCSED 528 >SB_42361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 286 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/36 (27%), Positives = 24/36 (66%) Frame = +3 Query: 438 IEEKRQRLEEAEKKRQAMLQAMKEPARPDPTSPSKR 545 +E+ ++++EE +K+++A+L K D +PS++ Sbjct: 160 LEDAKKKIEELQKEKEAILLRTKATRTRDRVTPSRQ 195 >SB_32577| Best HMM Match : PH (HMM E-Value=7e-17) Length = 1248 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 462 EEAEKKRQAMLQAMKEPARPDPTSPSKRRAK 554 EE K +A+ K PA P PT PS+ R++ Sbjct: 938 EEKTKSTEAVSPKPKRPAPPRPTVPSQGRSE 968 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,751,512 Number of Sequences: 59808 Number of extensions: 269992 Number of successful extensions: 1281 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1280 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -