BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0404.Seq (626 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46267-2|CAC42301.1| 600|Caenorhabditis elegans Hypothetical pr... 29 3.6 AL132904-14|CAC35847.2| 258|Caenorhabditis elegans Hypothetical... 29 3.6 AF242767-1|AAG36874.1| 258|Caenorhabditis elegans SF2 protein. 29 3.6 AF228712-1|AAF34798.1| 91|Caenorhabditis elegans molybdenum co... 29 3.6 >Z46267-2|CAC42301.1| 600|Caenorhabditis elegans Hypothetical protein F49E2.1b protein. Length = 600 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +1 Query: 157 RDRVECCSSLEQESTIKERGLQRQRAKNRLSGRGPLREPS 276 RDR+ C S EQ S + ++ + ++A++ + G EP+ Sbjct: 343 RDRIRCGDSDEQLSEVIQKAVNNKKARHAVFRNGRSEEPA 382 >AL132904-14|CAC35847.2| 258|Caenorhabditis elegans Hypothetical protein Y111B2A.18 protein. Length = 258 Score = 28.7 bits (61), Expect = 3.6 Identities = 31/89 (34%), Positives = 41/89 (46%), Gaps = 3/89 (3%) Frame = -3 Query: 549 RKINK*GFRAHFPESAT*RAL*RRIKRGGCGGYAQRDRYTCQRPSAR---SFRFLPFLSR 379 RK++ FR+H E+A R GG GG RDR + P A S ++ P SR Sbjct: 175 RKLDDTKFRSHEGETAYIRVREDNSSGGGSGG-GGRDRSRSRSPRAERRASPKYSPRRSR 233 Query: 378 HVRRLSPSSSKSGAPFRVPI*CFTAPRPQ 292 R S S S+S + R P +P PQ Sbjct: 234 S-RSRSRSRSRSRSASRSP---SRSPSPQ 258 >AF242767-1|AAG36874.1| 258|Caenorhabditis elegans SF2 protein. Length = 258 Score = 28.7 bits (61), Expect = 3.6 Identities = 31/89 (34%), Positives = 41/89 (46%), Gaps = 3/89 (3%) Frame = -3 Query: 549 RKINK*GFRAHFPESAT*RAL*RRIKRGGCGGYAQRDRYTCQRPSAR---SFRFLPFLSR 379 RK++ FR+H E+A R GG GG RDR + P A S ++ P SR Sbjct: 175 RKLDDTKFRSHEGETAYIRVREDNSSGGGSGG-GGRDRSRSRSPRAERRASPKYSPRRSR 233 Query: 378 HVRRLSPSSSKSGAPFRVPI*CFTAPRPQ 292 R S S S+S + R P +P PQ Sbjct: 234 S-RSRSRSRSRSRSASRSP---SRSPSPQ 258 >AF228712-1|AAF34798.1| 91|Caenorhabditis elegans molybdenum cofactor synthesis-step1 protein MOCS1A-B protein. Length = 91 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +1 Query: 157 RDRVECCSSLEQESTIKERGLQRQRAKNRLSGRGPLREPS 276 RDR+ C S EQ S + ++ + ++A++ + G EP+ Sbjct: 21 RDRIRCGDSDEQLSEVIQKAVNNKKARHAVFRNGRSEEPA 60 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,388,200 Number of Sequences: 27780 Number of extensions: 270630 Number of successful extensions: 547 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1374536540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -