BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0401.Seq (745 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A3UB32 Cluster: Thymidylate synthase; n=1; Croceibacter... 33 7.4 UniRef50_A6PLS4 Cluster: Putative uncharacterized protein precur... 33 9.8 >UniRef50_A3UB32 Cluster: Thymidylate synthase; n=1; Croceibacter atlanticus HTCC2559|Rep: Thymidylate synthase - Croceibacter atlanticus HTCC2559 Length = 119 Score = 33.1 bits (72), Expect = 7.4 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -2 Query: 603 GYPTLQTETHYCFTAEIGRVVVPTRADSQDVLHHYKRRKKINISDVKSRT 454 G+ TL+ HY F + T S+DVL+H+ +RK + I D K T Sbjct: 8 GFATLELTEHYSFV-NLKENCNMTLEQSKDVLNHFGKRKYVIIVDRKEET 56 >UniRef50_A6PLS4 Cluster: Putative uncharacterized protein precursor; n=1; Victivallis vadensis ATCC BAA-548|Rep: Putative uncharacterized protein precursor - Victivallis vadensis ATCC BAA-548 Length = 219 Score = 32.7 bits (71), Expect = 9.8 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 646 P*DMSSNDSVFKVQRLPHPSNRNALLLHGRNRQGGGTYP 530 P + S D K+ RLPHPS R LL+ G +GG P Sbjct: 127 PGEWRSTDGFCKISRLPHPS-RQILLMEGSFLEGGTGAP 164 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 769,606,528 Number of Sequences: 1657284 Number of extensions: 15813900 Number of successful extensions: 32200 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32185 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60911752460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -