BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0400X.Seq (492 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19865| Best HMM Match : cNMP_binding (HMM E-Value=8.3e-39) 81 5e-16 SB_12691| Best HMM Match : cNMP_binding (HMM E-Value=1.7e-26) 61 4e-10 SB_58379| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_52453| Best HMM Match : cNMP_binding (HMM E-Value=1.9e-26) 58 4e-09 SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) 34 0.055 SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.073 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_49169| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.22 SB_49167| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.39 SB_56249| Best HMM Match : cNMP_binding (HMM E-Value=5.4e-23) 31 0.52 SB_21541| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.90 SB_27554| Best HMM Match : cNMP_binding (HMM E-Value=2.6) 30 1.2 SB_36287| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_11282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_53355| Best HMM Match : CHCH (HMM E-Value=3.3e-07) 29 2.1 SB_44854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_10829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 29 2.8 SB_15073| Best HMM Match : MED7 (HMM E-Value=2.1) 29 2.8 SB_5593| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 29 2.8 SB_33011| Best HMM Match : cNMP_binding (HMM E-Value=0.037) 28 3.6 SB_19362| Best HMM Match : M (HMM E-Value=0.0014) 28 3.6 SB_18428| Best HMM Match : cNMP_binding (HMM E-Value=0.037) 28 3.6 SB_26117| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_12667| Best HMM Match : Caudal_act (HMM E-Value=6.7) 28 4.8 SB_47365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) 28 4.8 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_3203| Best HMM Match : FGF (HMM E-Value=0.013) 28 4.8 SB_52940| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_58207| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_11281| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_7057| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42875| Best HMM Match : RGM_C (HMM E-Value=2.6e-27) 27 8.4 SB_27965| Best HMM Match : Sec61_beta (HMM E-Value=0.84) 27 8.4 SB_7359| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 >SB_19865| Best HMM Match : cNMP_binding (HMM E-Value=8.3e-39) Length = 373 Score = 81.0 bits (191), Expect = 5e-16 Identities = 37/93 (39%), Positives = 59/93 (63%), Gaps = 1/93 (1%) Frame = +3 Query: 216 KEIRARRVRNQTGDDGDNFYVIENGVFDVLVTGDDRVEKV-VHTYEGSGSFGELALMYNM 392 K++ + + GD+GDNFYVI G +DV + + VHT+ G+G FGELALM+N Sbjct: 142 KKVSPEEIIIKVGDEGDNFYVINTGEYDVFALDTNTGASIKVHTFNGTGMFGELALMHNS 201 Query: 393 PLAASVRSQTAGALWAMDRHTFRRILLKSAFKK 491 A++ ++T G LWA+DR TF ++++ A ++ Sbjct: 202 LRNATIVAKTEGTLWALDRSTFVQVVVGGAQRR 234 Score = 33.5 bits (73), Expect = 0.097 Identities = 24/66 (36%), Positives = 32/66 (48%) Frame = +3 Query: 273 YVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPLAASVRSQTAGALWAMDRH 452 Y IE G V V D VEK V FGELAL+ N P +ASV + ++ + Sbjct: 286 YFIEKGKVRVTVK-DGEVEKTVEF--DKNYFGELALVMNQPRSASVYAVGECKFASLKKD 342 Query: 453 TFRRIL 470 F R++ Sbjct: 343 DFERLM 348 >SB_12691| Best HMM Match : cNMP_binding (HMM E-Value=1.7e-26) Length = 376 Score = 61.3 bits (142), Expect = 4e-10 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 1/80 (1%) Frame = +3 Query: 255 DDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSG-SFGELALMYNMPLAASVRSQTAGA 431 + G + YV+E G V G V + G G +FGELA++YN ASVR+QT+G Sbjct: 185 EPGSHLYVLEEGKCQVTKEG------TVLGHMGPGKAFGELAILYNCTRTASVRAQTSGK 238 Query: 432 LWAMDRHTFRRILLKSAFKK 491 LWA+DR TF+ I++K+ + Sbjct: 239 LWAIDRQTFQTIMMKTGLMR 258 >SB_58379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 58.4 bits (135), Expect = 3e-09 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = +2 Query: 5 EPPVARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSL 175 EPP R+ RR+SV AE + P+ +D + P V+PK+D QR RL +A++ ILLF++L Sbjct: 92 EPPKNRYA-RRQSVCAEPFHPDSEDEGDEQPIVYPKTDEQRQRLNDAIKNILLFKNL 147 Score = 31.9 bits (69), Expect = 0.30 Identities = 11/26 (42%), Positives = 21/26 (80%) Frame = +1 Query: 178 RAQMQQVLDAMFGKRSEPGEYVIRQG 255 + Q+ +VLDAMF ++++ G+++I QG Sbjct: 149 KEQLNEVLDAMFERKTQAGDHIIDQG 174 Score = 27.9 bits (59), Expect = 4.8 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 252 GDDGDNFYVIE 284 GDDGDNFYVI+ Sbjct: 174 GDDGDNFYVID 184 >SB_52453| Best HMM Match : cNMP_binding (HMM E-Value=1.9e-26) Length = 370 Score = 58.0 bits (134), Expect = 4e-09 Identities = 27/53 (50%), Positives = 38/53 (71%) Frame = +3 Query: 333 VVHTYEGSGSFGELALMYNMPLAASVRSQTAGALWAMDRHTFRRILLKSAFKK 491 +V T GSFGELAL+Y P AA+++++T LWA+DR T+RRIL+ S +K Sbjct: 179 LVSTIGEGGSFGELALIYGTPRAATIKAKTDVKLWAIDRVTYRRILMGSQIRK 231 Score = 41.9 bits (94), Expect = 3e-04 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 3/76 (3%) Frame = +3 Query: 252 GDDGDNFYVIENGVFDVLV---TGDDRVEKVVHTYEGSGSFGELALMYNMPLAASVRSQT 422 G+ GD F++I G VL +D +E V S FGE+AL+ N P AA+V+++ Sbjct: 275 GEHGDEFFIIVEGTAVVLQRRSANEDFIE--VSRLGPSDYFGEIALVLNRPRAATVQARG 332 Query: 423 AGALWAMDRHTFRRIL 470 +DR F R+L Sbjct: 333 TLKCVKLDRQRFERVL 348 >SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) Length = 858 Score = 34.3 bits (75), Expect = 0.055 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 2/77 (2%) Frame = +3 Query: 246 QTGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGS-FGELALM-YNMPLAASVRSQ 419 ++G GD Y I+ G+ D+L E + T G GS FGE+ L+ ASVR+ Sbjct: 653 RSGHRGDKMYFIQKGIVDILTR-----EGALATSLGDGSHFGEICLLTKEARRVASVRAA 707 Query: 420 TAGALWAMDRHTFRRIL 470 T ++++ F +L Sbjct: 708 TTCDVYSLSATHFHEVL 724 >SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 33.9 bits (74), Expect = 0.073 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +3 Query: 3 KSRQWRALTIGANPFSPRLMTPKRMILTKEPLPCSPSRTHREPVSLRRS 149 KS + RA ++ ++P+ +TPK ++ ++ L PSR P S +R+ Sbjct: 603 KSARTRAWSVSPRLYTPKSITPKFILSPRQTLSAPPSRPKTAPTSAQRT 651 >SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 32.7 bits (71), Expect = 0.17 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +2 Query: 32 RRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRS 172 RR SV E Y+P + A +PKS+ R RL + I +F+S Sbjct: 291 RRDSVAGEVYEPVNSNC-VSAQRFYPKSEDARKRLENVIGNIFIFKS 336 >SB_49169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 32.3 bits (70), Expect = 0.22 Identities = 25/74 (33%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = +2 Query: 14 VARFNNRRKSVFAETYDPEEDDSDEGAPAVFP--KSDAQRARLAE---AVRGILLFRSLD 178 V R K A+ D E D +EGAPA P K RA L E A +G + D Sbjct: 114 VDRVKKMHKKKMAKKEDEEMDVPEEGAPAKKPAVKKLGSRAALRECIAAAKGKGCNNTKD 173 Query: 179 AHKCSRFWMRCSER 220 C+R ++ C +R Sbjct: 174 CRPCARGFVLCMKR 187 >SB_49167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 31.5 bits (68), Expect = 0.39 Identities = 24/74 (32%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = +2 Query: 14 VARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSD--AQRARLAE---AVRGILLFRSLD 178 V R K A+ D E D +EGAPA P + RA L E A +G + D Sbjct: 114 VDRVKKMHKKKMAKKEDEEMDVPEEGAPAKKPAVEKLGSRAALRECIAAAKGKGCNNTKD 173 Query: 179 AHKCSRFWMRCSER 220 C+R ++ C +R Sbjct: 174 CRPCARGFVLCMKR 187 >SB_56249| Best HMM Match : cNMP_binding (HMM E-Value=5.4e-23) Length = 279 Score = 31.1 bits (67), Expect = 0.52 Identities = 19/73 (26%), Positives = 33/73 (45%) Frame = +3 Query: 252 GDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPLAASVRSQTAGA 431 GD G Y I G ++L + V+ T FGE+ L+Y A+V+++T Sbjct: 157 GDMGREMYCIRRGQVNILCE-----DNVIGTLGPGSFFGEIGLIYGESRFATVQAKTYCQ 211 Query: 432 LWAMDRHTFRRIL 470 + + +H +L Sbjct: 212 ILMLTKHDLDEVL 224 >SB_21541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 30.7 bits (66), Expect = 0.68 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 21 ALTIGANPFSPRLMTPKRMILTKEPLPCSPSRTHREPVSL 140 ALT + PFSP + P + LT P SP++ P SL Sbjct: 61 ALTAYSRPFSPDSLFPPPLALTAYSRPFSPAKLIARPFSL 100 >SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 30.3 bits (65), Expect = 0.90 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = +3 Query: 246 QTGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPLAASV 410 Q GD G+ Y I +G V R KV+ FGELA++YN A+V Sbjct: 515 QEGDAGNALYAIADGRLQVT-----RENKVLGEMVAGMVFGELAILYNCRRTATV 564 >SB_27554| Best HMM Match : cNMP_binding (HMM E-Value=2.6) Length = 82 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = +3 Query: 357 GSFGELALMYNMPLAASVRSQTAGALWAMDRHTFRRIL 470 G FGELAL+ + AASV S ++D H F R+L Sbjct: 16 GYFGELALITHNTRAASVYSVGDCVCASLDVHAFERLL 53 >SB_36287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 29.5 bits (63), Expect = 1.6 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = -2 Query: 365 KRTGTFVCVDHLFDAVVSGDQDVENAVLDDVE-VVAVIPCLITYSPGSDLFPNIASRTCC 189 K + FVCVDH + V ++ A+L VE V +PC Y G +L TC Sbjct: 105 KHSSQFVCVDHDAEYVPGSVANLNGALLYPVEGVCGSLPC-APYVDGYEL-------TCV 156 Query: 188 ICAR 177 +C + Sbjct: 157 VCTK 160 >SB_11282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +3 Query: 330 KVVHTYEGSGSFGELALMYNMPLAASVRSQTAGALWAMDRHTFRRI 467 K++ G SFGELALM+++ A++ + +D+ F + Sbjct: 234 KIISEMTGGDSFGELALMHDIRRTATIICKERSEFLRVDKDDFNEM 279 >SB_53355| Best HMM Match : CHCH (HMM E-Value=3.3e-07) Length = 599 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 189 AAGSGCDVRKEIRARRVRNQTGDDGD 266 +AGS D RK +RAR + + T DD + Sbjct: 416 SAGSDADTRKNLRARSMVSTTSDDSE 441 >SB_44854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 389 VVHQGQFAKRTGTFVCVDHLFDAVV 315 +VH G RTGTF+ +D L D +V Sbjct: 489 LVHCGAGVGRTGTFIAIDSLMDQMV 513 >SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 28.7 bits (61), Expect = 2.8 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -2 Query: 365 KRTGTFVCVDHLFDAVVSGDQDVENAVLDDVE-VVAVIPC 249 K + FVCVDH + V DV A+L VE +PC Sbjct: 105 KHSSQFVCVDHDAEYVPGSGADVNGALLYPVEGRCGSLPC 144 >SB_10829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 402 ASVRSQTAGALWAMDRHTFRRILLKSAFKK 491 A++R++ AG +D H F+RIL +FKK Sbjct: 70 AALRTKGAGGPSNVDAHGFQRILASKSFKK 99 >SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 998 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 60 MTPKRMILTKEPLPCSPSRTHRE 128 MTP R LT LPC SRT+ E Sbjct: 941 MTPSRASLTPTHLPCRDSRTNSE 963 >SB_15073| Best HMM Match : MED7 (HMM E-Value=2.1) Length = 644 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 402 ASVRSQTAGALWAMDRHTFRRILLKSAFKK 491 A++R++ AG +D H F+RIL +FKK Sbjct: 369 AALRTKGAGGPSNVDAHGFQRILASKSFKK 398 >SB_5593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 402 ASVRSQTAGALWAMDRHTFRRILLKSAFKK 491 A++R++ AG +D H F+RIL +FKK Sbjct: 388 AALRTKGAGGPSNVDAHGFQRILASKSFKK 417 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 28.7 bits (61), Expect = 2.8 Identities = 25/92 (27%), Positives = 31/92 (33%) Frame = +3 Query: 36 ANPFSPRLMTPKRMILTKEPLPCSPSRTHREPVSLRRSGAYCCSVLLTRTNAAGSGCDVR 215 ANP PR+ KR T RR G CC G G D Sbjct: 122 ANPHPPRVRKRKRKRPTATTTTTKQGPVCGRGGGGRRGGGGCCG------GGGGGGGDCT 175 Query: 216 KEIRARRVRNQTGDDGDNFYVIENGVFDVLVT 311 + A+ DD +N Y +E V V +T Sbjct: 176 CDEEAKEAVVVDNDDSNNSYEVEEKVIVVNMT 207 >SB_33011| Best HMM Match : cNMP_binding (HMM E-Value=0.037) Length = 210 Score = 28.3 bits (60), Expect = 3.6 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 252 GDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGS-FGELALM 383 G+ G Y+I +G +V+V EK+V G+ FGE++L+ Sbjct: 158 GEIGREMYIINHGKVEVVVPDSTTGEKIVVASLTEGNYFGEISLL 202 >SB_19362| Best HMM Match : M (HMM E-Value=0.0014) Length = 722 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +3 Query: 252 GDDGDNFYVIENGVFDV---LVTGDDRVEKVVHTYEGS 356 G DG+ + IENG DV L+ ++R+ +++ YEG+ Sbjct: 204 GRDGNKYMGIENGKADVSEKLLQENERLRELLRQYEGN 241 >SB_18428| Best HMM Match : cNMP_binding (HMM E-Value=0.037) Length = 210 Score = 28.3 bits (60), Expect = 3.6 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 252 GDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGS-FGELALM 383 G+ G Y+I +G +V+V EK+V G+ FGE++L+ Sbjct: 158 GEIGREMYIINHGKVEVVVPDSTTGEKIVVASLTEGNYFGEISLL 202 >SB_26117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.9 bits (59), Expect = 4.8 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = -2 Query: 365 KRTGTFVCVDHLFDAVVSGDQDVENAVLDDVE-VVAVIPCLITYSPGSDLFPNIASRTCC 189 K + FVCVDH + V + E A+L VE +PC Y G +L TC Sbjct: 97 KHSSQFVCVDHDAEYVPGTSVNREGALLYPVEGKCGSLPC-APYVDGYEL-------TCA 148 Query: 188 ICAR 177 +C + Sbjct: 149 VCTK 152 >SB_12667| Best HMM Match : Caudal_act (HMM E-Value=6.7) Length = 198 Score = 27.9 bits (59), Expect = 4.8 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = -2 Query: 365 KRTGTFVCVDHLFDAVVSGDQDVENAVLDDVE-VVAVIPCLITYSPGSDLFPNIASRTCC 189 K + FVCVDH + V + E A+L VE +PC Y G +L TC Sbjct: 143 KHSSQFVCVDHDAEYVPGTSVNREGALLYPVEGKCGSLPC-APYVDGYEL-------TCA 194 Query: 188 ICAR 177 +C + Sbjct: 195 VCTK 198 >SB_47365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 27.9 bits (59), Expect = 4.8 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +2 Query: 83 DEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAHKCSRFWMRCSERDPS 229 DE P V P DA R + I L S + S+FWM+CS+R+ S Sbjct: 446 DEARP-VLP--DAPRYPPINSGDKIALKMSYTSGDLSKFWMKCSDRECS 491 >SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) Length = 405 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 11 PVARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSD 118 P + S AE P E DS+EG P + P D Sbjct: 276 PAEPVEQSQDSGVAEAESPAEQDSEEGTPGMSPPVD 311 >SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 27.9 bits (59), Expect = 4.8 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +2 Query: 83 DEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAHKCSRFWMRCSERDPS 229 DE P V P DA R + I L S + S+FWM+CS+R+ S Sbjct: 36 DEARP-VLP--DAPRYPPINSGDKIALKMSYTSGDLSKFWMKCSDRECS 81 >SB_3203| Best HMM Match : FGF (HMM E-Value=0.013) Length = 423 Score = 27.9 bits (59), Expect = 4.8 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = -3 Query: 187 FVRVKRTEQQYAPDRLSETGSLCVRLGEHGRGSFVRIILFG--VISLGENGFAPIVKARH 14 ++R+ R + Y RL G + +RL HG+ ++R+ G I L +G I RH Sbjct: 265 YIRLNRHGKMYI--RLDRNGKMYIRLNRHGK-MYIRLNRHGKMYIRLNRHGKMYIRLNRH 321 Query: 13 WRLF 2 +++ Sbjct: 322 GKMY 325 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 187 FVRVKRTEQQYAPDRLSETGSLCVRLGEHGR 95 ++R+KR Q Y RL+ G + +RL HG+ Sbjct: 225 YIRLKRHGQMYI--RLNRHGKMYIRLNRHGK 253 >SB_52940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 27.5 bits (58), Expect = 6.4 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = -2 Query: 365 KRTGTFVCVDHLFDAVVSGDQDVENAVLDDVE-VVAVIPCLITYSPGSDLFPNIASRTCC 189 K + FVCVDH + V + E A+L VE +PC Y G +L TC Sbjct: 117 KHSSQFVCVDHDAEFVPGTSVNREGALLYPVEGRCGSLPC-APYVDGYEL-------TCA 168 Query: 188 ICAR 177 +C + Sbjct: 169 VCTK 172 >SB_58207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 359 TGTFVCVDHLFDAVVSGDQDVENAVLDDVEVVAVIPCLIT 240 T F+C+ V DQDV AV++ +++A+ +T Sbjct: 119 TSFFICIGKALQIVPFTDQDVRTAVVNIGQMIAMTSSFMT 158 >SB_11281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 27.1 bits (57), Expect = 8.4 Identities = 13/44 (29%), Positives = 27/44 (61%) Frame = +3 Query: 360 SFGELALMYNMPLAASVRSQTAGALWAMDRHTFRRILLKSAFKK 491 SFGELAL++++ A++ + +D+ F + LK+++K+ Sbjct: 223 SFGELALLHDIKRTATIICKGRAEFLRLDKPGFDEV-LKNSYKR 265 >SB_7057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 27.1 bits (57), Expect = 8.4 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -2 Query: 365 KRTGTFVCVDHLFDAVVSGDQDVENAVLDDVE-VVAVIPC 249 K + FVCVDH + + ++ A+L VE V +PC Sbjct: 152 KHSSQFVCVDHDAEYIPGSVANLNGALLYPVEGVCGSLPC 191 >SB_42875| Best HMM Match : RGM_C (HMM E-Value=2.6e-27) Length = 471 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 213 RKEIRARRVRNQTGDDGDNFYVIENGVFDVLVTGD 317 RK+I R + + D + +++ +FD+L TGD Sbjct: 363 RKKITRREAKKKCQDSNVTGFYLDSCMFDLLTTGD 397 >SB_27965| Best HMM Match : Sec61_beta (HMM E-Value=0.84) Length = 1737 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 350 FVCVDHLFDAVVSGDQDVENAVLDDVE 270 F+ +DH D+V S D ENAV ++E Sbjct: 1115 FINLDHESDSVKSSVADAENAVPSEIE 1141 >SB_7359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 27.1 bits (57), Expect = 8.4 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 412 RTDAASGMLYIRASSPNEPEPSYVWTTFSTRSSPVTRTSKTPF 284 R +A L I+ SSP + S V +T++T + VT T PF Sbjct: 99 RGNATIDWLAIQGSSPTMQQGSVVLSTWTTGTQCVTVTLPKPF 141 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,149,800 Number of Sequences: 59808 Number of extensions: 359567 Number of successful extensions: 1444 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 1263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1423 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -