BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0399.Seq (582 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 6.7 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 6.7 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 8.9 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 219 ESTFFNSGLLFQTGTTLNPI 160 E + SG L+ TT+NPI Sbjct: 307 EWLYILSGCLYYFSTTINPI 326 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 Query: 45 ICHSPFSVRNCWEG 4 IC PF V N W G Sbjct: 346 ICWLPFFVVNLWSG 359 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.0 bits (42), Expect = 8.9 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 413 ALGRWQV*RSRCA*PPH--PPRLMRRYRARQ 499 A+G WQ+ C+ PP PP R R+ Sbjct: 381 AMGHWQMSCVACSPPPRQTPPSRKESGRRRR 411 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,119 Number of Sequences: 438 Number of extensions: 3281 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -