BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0388.Seq (784 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 26 0.39 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 6.4 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 25.8 bits (54), Expect = 0.39 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 61 LDHLYLKL*KYFEYTVLPR 5 L HL K+ ++FEY VLPR Sbjct: 178 LAHLVPKIAEFFEYRVLPR 196 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 419 SLISNCRCHNAMQSKLPKLTVKCKY*FYYLLIVINY 526 +LI C C + SK+ K K ++ F +V+N+ Sbjct: 252 TLIIMCDCVRSEASKVVKNAQKLRHKFDLKTLVLNF 287 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,851 Number of Sequences: 336 Number of extensions: 3629 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -