BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0388.Seq (784 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 25 3.5 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 6.1 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 23 8.1 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 24.6 bits (51), Expect = 3.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -3 Query: 287 SR*IISVNSKHYSIQLRTVNVAGEKPKFPRLSVIVSTFP 171 +R ++V + + I T+NV P FP +VI+ +P Sbjct: 62 NRVFVAVARRRWGIP-STLNVVDLSPPFPNTNVILKPYP 99 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 6.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 610 YNWKKSELCPLLIIIDFIKLFGYS 539 Y W K EL LL+ + +GY+ Sbjct: 96 YRWNKKELNELLVAAKYHDEYGYA 119 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 23.4 bits (48), Expect = 8.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 455 ASRCDIDSWKLNC 417 A RCD+D+ K NC Sbjct: 21 AGRCDLDNNKTNC 33 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 768,622 Number of Sequences: 2352 Number of extensions: 14224 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -