BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0388.Seq (784 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC113014-1|AAI13015.1| 245|Homo sapiens ring finger protein 151... 30 8.2 BC029501-1|AAH29501.2| 244|Homo sapiens RNF151 protein protein. 30 8.2 >BC113014-1|AAI13015.1| 245|Homo sapiens ring finger protein 151 protein. Length = 245 Score = 30.3 bits (65), Expect = 8.2 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = -2 Query: 309 VILKVQSLPMNHL-CKQ*TL--LDSTSNCQCCRRETKVSKIV 193 V+ + LP +H+ CK+ L L C CCR+E K K+V Sbjct: 26 VLKRPARLPCSHIFCKKCILRWLARQKTCPCCRKEVKRKKVV 67 >BC029501-1|AAH29501.2| 244|Homo sapiens RNF151 protein protein. Length = 244 Score = 30.3 bits (65), Expect = 8.2 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = -2 Query: 309 VILKVQSLPMNHL-CKQ*TL--LDSTSNCQCCRRETKVSKIV 193 V+ + LP +H+ CK+ L L C CCR+E K K+V Sbjct: 25 VLKRPARLPCSHIFCKKCILRWLARQKTCPCCRKEVKRKKVV 66 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,449,640 Number of Sequences: 237096 Number of extensions: 1930139 Number of successful extensions: 3110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3110 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9534535578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -