BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0385.Seq (790 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 28 0.29 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 28.3 bits (60), Expect = 0.29 Identities = 26/93 (27%), Positives = 37/93 (39%), Gaps = 4/93 (4%) Frame = -3 Query: 341 FNRNNFSIRYWSWNYRGCWHQTCPPIVPRKIFK---VYSFRLRGLVRVPY-RYFSSLPPV 174 F R + + W++ + + PP V RK + Y + L R RY L + Sbjct: 212 FFREDIGVNLHHWHWHLVYPASGPPDVVRKDRRGELFYYMHQQLLARYQIDRYAQGLGRI 271 Query: 173 PGVGNLRACCLPWMW*PFLRLPLRNRTLIPRYP 75 + NLR + LR NRT PRYP Sbjct: 272 EPLANLREPVREAYYPKLLRTS-NNRTFCPRYP 303 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 811,969 Number of Sequences: 2352 Number of extensions: 17159 Number of successful extensions: 32 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -