BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0379.Seq (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_03_0053 + 14109636-14109948,14110075-14110302,14112030-141121... 28 7.4 01_05_0005 - 16886553-16886946,16887079-16887404 28 7.4 >03_03_0053 + 14109636-14109948,14110075-14110302,14112030-14112181, 14112305-14112578,14112687-14112739 Length = 339 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 167 YLGVLQTNKIEPRSYSIIPCTKYSSSIFSRFEHSNLFK 280 YLG+ NK+ P+ Y + C K+ + FS++ H++ K Sbjct: 255 YLGIFP-NKLSPKDYDVFGCIKWLND-FSKY-HNHALK 289 >01_05_0005 - 16886553-16886946,16887079-16887404 Length = 239 Score = 27.9 bits (59), Expect = 7.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 459 RNNFSIRYWSWNYRGC 506 R+N S RYW W GC Sbjct: 90 RSNSSFRYWRWQPHGC 105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,448,552 Number of Sequences: 37544 Number of extensions: 311731 Number of successful extensions: 676 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -