BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0379.Seq (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 28 6.1 At2g43930.1 68415.m05460 protein kinase family protein contains ... 27 8.1 At1g23300.1 68414.m02914 MATE efflux family protein similar to r... 27 8.1 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 564 PITRPRKSPVSLSFVTTSPCREWVICAP 647 PI+ P KSP + S TTSP + + +P Sbjct: 24 PISSPTKSPTTPSAPTTSPTKSPAVTSP 51 >At2g43930.1 68415.m05460 protein kinase family protein contains similarity to NPK1-related protein kinase 2 GI:2342425 from [Arabidopsis thaliana] Length = 204 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +2 Query: 197 EPRSYSIIPCTKYSSSIFSRFEHSNLFKVKLSAHLDTHR 313 EP ++ C K S S FEH LFK + + H+ Sbjct: 63 EPHIVLLLQCRKKSWCFASEFEHLKLFKGYIDEDEERHK 101 >At1g23300.1 68414.m02914 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 515 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -3 Query: 592 TGLLRGLVIGMSTTLNILTRNNWR--ASLVQ 506 TG+L G V+ S L I+ R NW+ ASL + Sbjct: 451 TGMLTGTVVQTSVLLFIIYRTNWKKEASLAE 481 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,097,716 Number of Sequences: 28952 Number of extensions: 251135 Number of successful extensions: 617 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 617 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -