BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0377.Seq (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 28 0.070 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 28 0.070 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 28 0.070 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 27 0.16 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 27 0.16 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 24 0.86 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 24 1.1 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 2.6 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 8.1 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 21 8.1 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 21 8.1 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 27.9 bits (59), Expect = 0.070 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = +1 Query: 433 ITLRVTTTPAALNAQLQGASGGTFREMCAEPLFVYFSKYIQ 555 IT +TT A L + GA R M PLF Y YIQ Sbjct: 151 ITEEITTHQADLIIEADGAYSTLRRYMQLTPLFEYSQTYIQ 191 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 27.9 bits (59), Expect = 0.070 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = +1 Query: 433 ITLRVTTTPAALNAQLQGASGGTFREMCAEPLFVYFSKYIQ 555 IT +TT A L + GA R M PLF Y YIQ Sbjct: 151 ITEEITTHQADLIIEADGAYSTLRRYMQLTPLFEYSQTYIQ 191 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 27.9 bits (59), Expect = 0.070 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = +1 Query: 433 ITLRVTTTPAALNAQLQGASGGTFREMCAEPLFVYFSKYIQ 555 IT +TT A L + GA R M PLF Y YIQ Sbjct: 151 ITEEITTHQADLIIEADGAYSTLRRYMQLTPLFEYSQTYIQ 191 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 26.6 bits (56), Expect = 0.16 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 583 GYCLMSGYIFECI*KNKQIGVPRTFPEKCHLT 488 GY G I E + KN+ G+P F E H T Sbjct: 306 GYTTREGMIVEMMRKNETPGMPNDFEEFVHPT 337 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 26.6 bits (56), Expect = 0.16 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 583 GYCLMSGYIFECI*KNKQIGVPRTFPEKCHLT 488 GY G I E + KN+ G+P F E H T Sbjct: 306 GYTTREGMIVEMMRKNETPGMPNDFEEFVHPT 337 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 24.2 bits (50), Expect = 0.86 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 583 GYCLMSGYIFECI*KNKQIGVPRTFPEKCHLT 488 GY G I E + K + G+P F E H T Sbjct: 304 GYTTREGMIVEMMRKTETPGMPNDFEEFVHPT 335 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 23.8 bits (49), Expect = 1.1 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 583 GYCLMSGYIFECI*KNKQIGVPRTFPEKCHLT 488 GY G I E + KN+ G+P F H T Sbjct: 304 GYTTREGMIVEMMRKNETPGMPNDFEGFVHPT 335 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 184 KSPLLKNVDSNVKGRKTVYQGDGPY 258 K PL+ + ++G K + DGPY Sbjct: 872 KYPLINAMRQELEGYKVKLEYDGPY 896 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +1 Query: 238 YQGDGPYVNHHPNQVFWGRGAVKH 309 YQG+ P NH+ G V H Sbjct: 381 YQGEHPNYNHYGYHYSGDGGEVAH 404 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 496 GTFREMCAEPLFVYFSKY 549 G FRE AE + +YF Y Sbjct: 140 GYFREYLAEAVQLYFQFY 157 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +1 Query: 238 YQGDGPYVNHHPNQVFWGRGAVKH 309 YQG+ P NH+ G V H Sbjct: 329 YQGEHPNYNHYGYHYSGDGGEVAH 352 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,108 Number of Sequences: 336 Number of extensions: 2424 Number of successful extensions: 14 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -