BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0374.Seq (692 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAP27G11.05c |vps41||vacuolar protein sorting-associated protei... 29 0.64 SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp... 28 1.1 SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces ... 27 1.9 SPCC330.08 |alg11|gmd3|alpha-1,2-mannosyltransferase Alg11|Schiz... 26 4.5 SPAC7D4.11c |sec39||secretory pathway protein Sec39 |Schizosacch... 26 4.5 SPBC119.15 |||AAA family ATPase, unknown biological role|Schizos... 26 5.9 >SPAP27G11.05c |vps41||vacuolar protein sorting-associated protein Vps41|Schizosaccharomyces pombe|chr 1|||Manual Length = 886 Score = 29.1 bits (62), Expect = 0.64 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 263 EKTNKKSWDACIDYVLNIPEYFCT 334 E+ +++ WD I Y L+ PE+ CT Sbjct: 693 EQADRELWDDLISYSLDKPEFICT 716 >SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1086 Score = 28.3 bits (60), Expect = 1.1 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 288 SQDFLFVFSSRRISSSGIC 232 S D L++F RR SSSGIC Sbjct: 923 SSDGLYIFGMRRKSSSGIC 941 >SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1877 Score = 27.5 bits (58), Expect = 1.9 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Frame = -2 Query: 406 PSNIYSVTFLLRIRSFVNIK-RHGTSTKILRYVQNVIDTSVPRFFICFFESAYLLVRYML 230 PS+ FL + +S +N+ + + T LR +Q + TS FF+ + A L Y+ Sbjct: 273 PSSPEEKPFLTQFQSILNLSDKFLSKTGTLR-LQEKLGTSCNLFFVLVLKLALLSSSYIG 331 Query: 229 SMLSTSSQSVQHTMGSLPRTP 167 + T S + +GS+ P Sbjct: 332 FVPYTYSDWINVLLGSISEDP 352 >SPCC330.08 |alg11|gmd3|alpha-1,2-mannosyltransferase Alg11|Schizosaccharomyces pombe|chr 3|||Manual Length = 471 Score = 26.2 bits (55), Expect = 4.5 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 4/94 (4%) Frame = -2 Query: 502 QPLRLLRARPEPQQRHEGELRSFGV-FTAYR*LPSNIYSVTFLL--RIRSFVN-IKRHGT 335 +P L A+ P++ HE LRSF + F + P+ + V + FVN +K T Sbjct: 276 EPTLLYLAQYRPEKNHENVLRSFALYFEQHPDSPAKLLLVGSVRGEEDMCFVNHLKTLAT 335 Query: 334 STKILRYVQNVIDTSVPRFFICFFESAYLLVRYM 233 + V+ V+D P+ + + + + V YM Sbjct: 336 ELNLQSKVKFVVDAPWPK-VVEYLGTCSIGVNYM 368 >SPAC7D4.11c |sec39||secretory pathway protein Sec39 |Schizosaccharomyces pombe|chr 1|||Manual Length = 769 Score = 26.2 bits (55), Expect = 4.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 236 IPDEEIRRLEKTNKKSWDACIDYVLNIPEYF 328 +PDEE+ +L TN K W+ + + + E++ Sbjct: 91 LPDEELCQLRLTNMKLWNCKLPSLKDEAEFY 121 >SPBC119.15 |||AAA family ATPase, unknown biological role|Schizosaccharomyces pombe|chr 2|||Manual Length = 367 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 269 TNKKSWDACIDYVLNIPEYFCTST 340 T SW CI YV++ P TST Sbjct: 131 TLASSWPTCIAYVVDTPRATSTST 154 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,555,420 Number of Sequences: 5004 Number of extensions: 50564 Number of successful extensions: 123 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -