BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0368.Seq (676 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 24 0.99 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.3 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 24.2 bits (50), Expect = 0.99 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 485 PPPSSETPRHPGAVQAHL 538 P SS TPRH Q HL Sbjct: 424 PESSSSTPRHEWVAQNHL 441 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 179 RLHFFMPGFAPLTSRGSRQYRALTVPSSRN 268 R MP +T + QYR + + +SRN Sbjct: 191 RDQLLMPNDVSITDEPAYQYRGIALDTSRN 220 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +2 Query: 389 TSKTRTPHTSWNGSPTT*RPPCATFPLV 472 ++ TR T+W TT PP P V Sbjct: 1069 STTTRPTTTNWPTQGTTIPPPAVVMPEV 1096 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,677 Number of Sequences: 336 Number of extensions: 3627 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -