BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0368.Seq (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 2.7 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 3.5 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 6.1 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.1 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 8.1 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 8.1 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 8.1 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.0 bits (47), Expect = 2.7 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +3 Query: 162 TWFPSRVSTSSCQVSLPSHPVEADSTV 242 +W P + SSC++++ P + S + Sbjct: 147 SWKPPAIYKSSCEINVEYFPFDEQSCI 173 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -1 Query: 214 EGSETWHEEVETREGNHVYGQFSEISVQLTGEPKASGDT 98 +GS T H E+E H+ ++ V + P+ S T Sbjct: 47 QGSRTTHNELEKNRRAHLRNCLEKLKVLVPLGPETSRHT 85 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/35 (25%), Positives = 15/35 (42%) Frame = +3 Query: 138 LISENWP*TWFPSRVSTSSCQVSLPSHPVEADSTV 242 LI N W P + SSC + + P + + + Sbjct: 132 LIYPNGDVLWVPPAIYQSSCTIDVTYFPFDQQTCI 166 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -1 Query: 628 SASVNSISSMPSPVYQCKKALR-LNIAVN 545 +AS NS+ S+P ++ + LR +++A N Sbjct: 267 NASYNSLDSLPEGLFASTRDLREIHLAYN 295 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +3 Query: 165 WFPSRVSTSSCQVSLPSHPVEADSTV 242 W P V SSC + + P + + V Sbjct: 143 WQPPAVYKSSCSIDVEFFPYDVQTCV 168 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/26 (26%), Positives = 13/26 (50%) Frame = +3 Query: 165 WFPSRVSTSSCQVSLPSHPVEADSTV 242 W P + SSC++ + P + + V Sbjct: 143 WKPPAIYKSSCEIDVEYFPFDEQTCV 168 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/26 (26%), Positives = 13/26 (50%) Frame = +3 Query: 165 WFPSRVSTSSCQVSLPSHPVEADSTV 242 W P + SSC++ + P + + V Sbjct: 139 WKPPAIYKSSCEIDVEYFPFDEQTCV 164 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,842 Number of Sequences: 438 Number of extensions: 4335 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -