BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0364.Seq (776 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7I1K2 Cluster: Putative uncharacterized protein; n=1; ... 39 0.12 UniRef50_Q2RLR7 Cluster: Putative uncharacterized protein; n=1; ... 33 8.0 >UniRef50_A7I1K2 Cluster: Putative uncharacterized protein; n=1; Campylobacter hominis ATCC BAA-381|Rep: Putative uncharacterized protein - Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 /CH001A) Length = 575 Score = 39.1 bits (87), Expect = 0.12 Identities = 24/67 (35%), Positives = 35/67 (52%) Frame = +3 Query: 228 GLCRLLAWFGTFIYYNIFKITGFFWILTAVIFRFINGILISFSSIGRSI*VVDTCHILM* 407 G+C L+ F IY+ +FKI+G + L AV IL F SI + + ++ Sbjct: 510 GICWLI--FEILIYFTLFKISGVWLFLVAVFVHIAIAILSIFISISQ---IFSLAFYILF 564 Query: 408 IVGFALF 428 I+GFALF Sbjct: 565 IIGFALF 571 >UniRef50_Q2RLR7 Cluster: Putative uncharacterized protein; n=1; Moorella thermoacetica ATCC 39073|Rep: Putative uncharacterized protein - Moorella thermoacetica (strain ATCC 39073) Length = 120 Score = 33.1 bits (72), Expect = 8.0 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 240 LLAWFGTFIYYNIFKITGFFWILTAVIFRFINGILIS 350 + +W+ +YYN+ + FW + A F+ G+L+S Sbjct: 50 IYSWYSGDVYYNVLILKMGFWFIIAFASSFVLGVLVS 86 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 738,584,319 Number of Sequences: 1657284 Number of extensions: 14251993 Number of successful extensions: 30538 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30537 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 65438977305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -