BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0364.Seq (776 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0295 + 7178921-7179451,7180083-7180448,7181316-7181450,718... 29 5.4 01_07_0168 + 41621762-41621768,41621892-41622827,41622943-41623898 29 5.4 >03_02_0295 + 7178921-7179451,7180083-7180448,7181316-7181450, 7181533-7181606,7181960-7181999,7182178-7182223, 7182398-7182477,7182585-7182760,7182848-7182973, 7183338-7183430,7184135-7184260,7184815-7184884, 7185262-7185344,7186216-7186329,7186884-7186983, 7187557-7187583 Length = 728 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 177 IFLCPCCLVSMKRQGT*GLCRLLAWFGTFIYYNIFK 284 +++ C LV Q +CR L+WF YY K Sbjct: 511 LYILACNLVKDYPQNCGSICRALSWFAVGCYYYCIK 546 >01_07_0168 + 41621762-41621768,41621892-41622827,41622943-41623898 Length = 632 Score = 28.7 bits (61), Expect = 5.4 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 238 AYWPGLELSYITIYSKLPA 294 AYWP + + YIT+ ++LPA Sbjct: 84 AYWPSVIIRYITVGNELPA 102 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,077,220 Number of Sequences: 37544 Number of extensions: 365626 Number of successful extensions: 677 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2080154268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -