BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0364.Seq (776 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003137-3|AAB93640.1| 625|Caenorhabditis elegans Hypothetical ... 29 2.8 AL132943-2|CAC14392.1| 367|Caenorhabditis elegans Hypothetical ... 28 8.6 >AF003137-3|AAB93640.1| 625|Caenorhabditis elegans Hypothetical protein C27A12.2 protein. Length = 625 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +2 Query: 218 RDMRSLSPIGLVWNFHILQYIQNYRLLLDTDGSNFPIYKWYTYQFQQ 358 +++ L G NF+ Q +QN +L D +G PIY++Y Q+ Q Sbjct: 217 KEIPKLKNPGFSINFNYFQ-VQNGLILQDFNGEPEPIYEFYEEQYVQ 262 >AL132943-2|CAC14392.1| 367|Caenorhabditis elegans Hypothetical protein Y116F11B.5 protein. Length = 367 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +3 Query: 279 FKITGFFWI---LTAVIFRFINGILISFSSI 362 F I F+WI + AVIF+FI IL+ S++ Sbjct: 219 FGIDDFYWIVYYIYAVIFQFIPSILLPISTV 249 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,026,525 Number of Sequences: 27780 Number of extensions: 344749 Number of successful extensions: 750 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1872168044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -