BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0363.Seq (786 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0622 - 8175226-8175312,8175674-8175763,8176370-8176457,817... 28 7.3 >04_01_0622 - 8175226-8175312,8175674-8175763,8176370-8176457, 8177021-8177095,8177754-8177821,8177898-8177955, 8178862-8178942,8179968-8180038,8180144-8180225, 8182327-8182449,8183023-8183129,8183201-8183263, 8183877-8183936,8184100-8184151,8185566-8185598, 8185820-8185871,8185965-8186028,8186693-8186749, 8186962-8187006,8187083-8187190,8188147-8188212, 8188382-8188492,8190841-8191035,8191419-8191499, 8191591-8191630,8191764-8191816 Length = 669 Score = 28.3 bits (60), Expect = 7.3 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 394 IINYLYKKNGKKFQCLDSQLAGSASLYLRVQ-LKEHNI*IR 275 ++N L GKK +D +LAG+ SL L+ LKE+ +R Sbjct: 25 LLNILKSIRGKKCVVIDPKLAGTLSLILQTSLLKEYGAELR 65 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,436,878 Number of Sequences: 37544 Number of extensions: 351129 Number of successful extensions: 622 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2115411120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -