BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0363.Seq (786 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -1 Query: 489 SCFNVNRLYRME--KKALSNLYTSV*RFYFSDSS*LITYIKKTGKNSSVL 346 +CF Y E K ALS + V RF + +S L Y++KTGK +V+ Sbjct: 292 NCFVGCDFYNSEELKTALSEQDSIVLRFAYLKTSALADYVQKTGKPQNVV 341 >SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 255 KKFNLRALIQILCSFNCTRR*SDALPAN 338 +K LRA Q C FNC R+ ++ P N Sbjct: 271 EKAKLRAFSQAHCKFNCHRKCAEKAPKN 298 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,403,003 Number of Sequences: 59808 Number of extensions: 430179 Number of successful extensions: 803 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 803 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -