BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0363.Seq (786 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 29 0.22 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 26 1.5 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 26 1.5 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 25 3.5 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 28.7 bits (61), Expect = 0.22 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 654 RSQKLVLVHNQRRYCTFTGGRT-SCESPRVGTRPAYFSVK 770 RSQ L V N+R Y T T RT S E P V + A+ + K Sbjct: 1041 RSQTLSPVRNERNYHTLTTTRTHSTERPFVAVQRAHDNAK 1080 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 126 IKNAVQEITKKKKNNTLSLFVYLNLILATI 215 I + +QEI++ K+NTL+ F L +L T+ Sbjct: 539 IADELQEISQVPKSNTLNKFTILARVLRTM 568 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 126 IKNAVQEITKKKKNNTLSLFVYLNLILATI 215 I + +QEI++ K+NTL+ F L +L T+ Sbjct: 539 IADELQEISQVPKSNTLNKFTILARVLRTM 568 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 24.6 bits (51), Expect = 3.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 347 KTLEFFPVFFI*VINYE 397 KT+ FFPV F+ IN E Sbjct: 577 KTIHFFPVLFLAAINPE 593 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,475 Number of Sequences: 2352 Number of extensions: 15818 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -