BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0363.Seq (786 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC132679-1|AAI32680.1| 1100|Homo sapiens transmembrane channel-l... 31 4.7 AY263163-1|AAP78778.1| 1129|Homo sapiens TMC3 protein protein. 31 4.7 AY236490-1|AAP69868.1| 724|Homo sapiens transmembrane channel-l... 31 4.7 >BC132679-1|AAI32680.1| 1100|Homo sapiens transmembrane channel-like 3 protein. Length = 1100 Score = 31.1 bits (67), Expect = 4.7 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +3 Query: 93 SNSKNVCHSNSIKNAVQEITKKKKNNTLSLFVYLNLILATITVFEKFGSV 242 + SK NSI+ A+ E +KKK+ L++ + L +I + + GS+ Sbjct: 285 AESKTAAIVNSIREAILEEQEKKKSKNLAVTICLRIIANILVLLSLAGSI 334 >AY263163-1|AAP78778.1| 1129|Homo sapiens TMC3 protein protein. Length = 1129 Score = 31.1 bits (67), Expect = 4.7 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +3 Query: 93 SNSKNVCHSNSIKNAVQEITKKKKNNTLSLFVYLNLILATITVFEKFGSV 242 + SK NSI+ A+ E +KKK+ L++ + L +I + + GS+ Sbjct: 284 AESKTAAIVNSIREAILEEQEKKKSKNLAVTICLRIIANILVLLSLAGSI 333 >AY236490-1|AAP69868.1| 724|Homo sapiens transmembrane channel-like protein 3 protein. Length = 724 Score = 31.1 bits (67), Expect = 4.7 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +3 Query: 93 SNSKNVCHSNSIKNAVQEITKKKKNNTLSLFVYLNLILATITVFEKFGSV 242 + SK NSI+ A+ E +KKK+ L++ + L +I + + GS+ Sbjct: 285 AESKTAAIVNSIREAILEEQEKKKSKNLAVTICLRIIANILVLLSLAGSI 334 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,496,235 Number of Sequences: 237096 Number of extensions: 1999309 Number of successful extensions: 3169 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3169 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9590293096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -