BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0358.Seq (699 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26H5.05 |||IPT/TIG ankyrin repeat protein|Schizosaccharomyce... 27 2.0 SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharo... 25 7.9 >SPAC26H5.05 |||IPT/TIG ankyrin repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1151 Score = 27.5 bits (58), Expect = 2.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 418 HKEGNSRTNRTDLLTSDPELASHLIVTV 501 H+E R+++ L DPE HL+ TV Sbjct: 279 HREDKKRSSKPQPLQPDPETVIHLVPTV 306 >SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 2244 Score = 25.4 bits (53), Expect = 7.9 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -3 Query: 493 QLGARQAPGQTLINQFGLFASFLPCVPLYSARLFVATYHRG 371 Q+ AR A T +FG +PC + S R ++ + + G Sbjct: 342 QIMARAAGASTTKMKFGNRGHNIPCTCMISGRCYITSQNHG 382 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,523,892 Number of Sequences: 5004 Number of extensions: 49182 Number of successful extensions: 103 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -