BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0358.Seq (699 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1647 + 35032328-35033803 33 0.16 >04_04_1647 + 35032328-35033803 Length = 491 Score = 33.5 bits (73), Expect = 0.16 Identities = 30/94 (31%), Positives = 40/94 (42%), Gaps = 8/94 (8%) Frame = -3 Query: 532 IYMSPYATILVL*QLGARQAPGQTLINQFGLFASFLPCVPLYSAR----LFVAT----YH 377 +Y Y LG P L+ + G S++PC Y R L A+ +H Sbjct: 81 LYPHSYGGYAFTVSLGTPPQPLPVLL-ETGSHLSWVPCTSSYQCRNCSSLSAASPLHVFH 139 Query: 376 RGLSSFTRNGAARPPSDVTCVSTSHCTDCRAASS 275 SS +R R PS + S H +DCRAASS Sbjct: 140 PKNSSSSRLIGCRNPSCLWIHSPDHLSDCRAASS 173 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,225,718 Number of Sequences: 37544 Number of extensions: 285259 Number of successful extensions: 618 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -