BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0357X.Seq (545 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56776| Best HMM Match : CRA_rpt (HMM E-Value=5.6e-17) 29 1.9 SB_46460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_15574| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 >SB_56776| Best HMM Match : CRA_rpt (HMM E-Value=5.6e-17) Length = 905 Score = 29.5 bits (63), Expect = 1.9 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 292 VSAVRGRDTRHI*GRPRCSVPSEGGKATMIGSDKQS--RRIQGDTRKETREQTELI 453 V+ RG D + + G RC+ S G +K S + QG T+K RE++E + Sbjct: 778 VTEGRGHDKKGMKGEARCAAESNEGSGHASEHEKASSLSQEQGRTKKTGREKSERV 833 >SB_46460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 28.7 bits (61), Expect = 3.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 342 ARPPSDVTCVSTSHCTDCRAASSR 271 +R PS + C S++HC CR+ + R Sbjct: 28 SRCPSSIHCPSSNHCRRCRSIARR 51 >SB_15574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +1 Query: 259 QTFYTR*SRTAVSAVRGRDTRHI*GRPRCSVPSEGGKATMIGSDKQSRR 405 QT+YTR + T H P CS P GG A + +SR+ Sbjct: 8 QTYYTRERSNSNPLQFHSGTEHEQVTPPCSPPYNGGSANQLSPIDKSRK 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,200,181 Number of Sequences: 59808 Number of extensions: 282102 Number of successful extensions: 722 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -